(data stored in ACNUC7421 zone)

EMBL: CP001743.PE303

CP001743.PE303       Location/Qualifiers
FT   CDS             complement(274085..275662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0307"
FT                   /product="alpha amylase catalytic region"
FT                   /EC_number="3.2.1.20"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; InterPro IPR006047:IPR006589;
FT                   KEGG: mrd:Mrad2831_1595 alpha amylase catalytic region;
FT                   COGs: COG0366 Glycosidase; SPTR: A3K7L1 Alpha amylase;
FT                   PFAM: Alpha amylase, C-terminal all-beta domain; Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27085"
FT                   /protein_id="ADD27085.1"
FT                   /translation="MEWWKTASIYQIYPRSFQDSNGDGIGDLPGIRKRLPYIRDLGFDA
FT                   IWLSPFYRSPMKDFGYDVADYCDVDPIFGTLKDFDELLAEAHRLGLKVLIDFVPNHTSD
FT                   QHPWFLESRSSRDNPKRDWYVWRDPAPDGGPPNNWQAHFGGPSWTLDEKTGQYYLHQFL
FT                   PEQPDLNWRNPEVRQAMYDVMRFWLDKGVDGFRVDVIWLLVEDALFRDEPDNPQYKPGD
FT                   IDRFRHIHIYQEDQPETREIVQEMRAVLDEYPGNRVMIGEIYLPYHQLIPYYGTPERPG
FT                   CHLPFNFHLISRGLNNWTAENIRSIVEEYEASLPPFATPNWVLGNHDQHRLATRIGHEQ
FT                   ARIAAMLLFTLRGSPTWYYGDEIGMVNGEIPPEKVQDPAALRQRGAAGEHGRDPERTPM
FT                   QWTPHAYAGFSTREPWLPINPDYPERNVEAQDADPFSMLTLVRTLLVVRKETPALLHGA
FT                   YQSYKAPQGVFAYLRGGEVLVALNFTQKPQALSTPGGEILLSTHLDRYGKVEGVLELRP
FT                   HEGLIVKL"
     MEWWKTASIY QIYPRSFQDS NGDGIGDLPG IRKRLPYIRD LGFDAIWLSP FYRSPMKDFG        60
     YDVADYCDVD PIFGTLKDFD ELLAEAHRLG LKVLIDFVPN HTSDQHPWFL ESRSSRDNPK       120
     RDWYVWRDPA PDGGPPNNWQ AHFGGPSWTL DEKTGQYYLH QFLPEQPDLN WRNPEVRQAM       180
     YDVMRFWLDK GVDGFRVDVI WLLVEDALFR DEPDNPQYKP GDIDRFRHIH IYQEDQPETR       240
     EIVQEMRAVL DEYPGNRVMI GEIYLPYHQL IPYYGTPERP GCHLPFNFHL ISRGLNNWTA       300
     ENIRSIVEEY EASLPPFATP NWVLGNHDQH RLATRIGHEQ ARIAAMLLFT LRGSPTWYYG       360
     DEIGMVNGEI PPEKVQDPAA LRQRGAAGEH GRDPERTPMQ WTPHAYAGFS TREPWLPINP       420
     DYPERNVEAQ DADPFSMLTL VRTLLVVRKE TPALLHGAYQ SYKAPQGVFA YLRGGEVLVA       480
     LNFTQKPQAL STPGGEILLS THLDRYGKVE GVLELRPHEG LIVKL                       525
//

If you have problems or comments...

PBIL Back to PBIL home page