(data stored in ACNUC7421 zone)

EMBL: CP001743.PE310

CP001743.PE310       Location/Qualifiers
FT   CDS             281884..283161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0314"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003660:IPR003661:IPR 005467;
FT                   KEGG: mpt:Mpe_A3149 sensor histidine kinase; COGs: COG0642
FT                   Signal transduction histidine kinase; SPTR: B8AD13 Putative
FT                   uncharacterized protein; PFAM: HAMP domain; His Kinase A
FT                   (phosphoacceptor) domain; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27092"
FT                   /protein_id="ADD27092.1"
FT                   /translation="MTLRLRLLLWLLLALVLLLFPLGALTVQQAQRTVQEALERAVLAR
FT                   LGFLVSQGIVRVQDLAQVVQEFGGVGFILGPEGRITFTDLGDYRLPEGLEQALRAGRGF
FT                   RQVRDNWLWVALPGEEGGLGLGTPLEEVAALPQRLLQLYLGLGGVLALLAFSVGAWGLT
FT                   RSLRPLETLSRELARRNAENLEPLPPPGLPEVRPAVEAMNALMGELEAALHRSRVQEQA
FT                   ARRFAYGASHELRNPLAALKGYLEVLQRRPGEPRATEGALREAARMESLLQGLLTLARL
FT                   EGQGRVRGQPLSLNAFLQQRGLRVEGDGWVEADPDLLALIVENLVQNATKHGGGVEKVE
FT                   LEPDAGGLWLWVCDRGPGFPPELQPRAFEPFVKSDQSDGVGLGLALVAAVARVMGAQVR
FT                   AENRPEGGARVGFWWPEARGRDKPVR"
     MTLRLRLLLW LLLALVLLLF PLGALTVQQA QRTVQEALER AVLARLGFLV SQGIVRVQDL        60
     AQVVQEFGGV GFILGPEGRI TFTDLGDYRL PEGLEQALRA GRGFRQVRDN WLWVALPGEE       120
     GGLGLGTPLE EVAALPQRLL QLYLGLGGVL ALLAFSVGAW GLTRSLRPLE TLSRELARRN       180
     AENLEPLPPP GLPEVRPAVE AMNALMGELE AALHRSRVQE QAARRFAYGA SHELRNPLAA       240
     LKGYLEVLQR RPGEPRATEG ALREAARMES LLQGLLTLAR LEGQGRVRGQ PLSLNAFLQQ       300
     RGLRVEGDGW VEADPDLLAL IVENLVQNAT KHGGGVEKVE LEPDAGGLWL WVCDRGPGFP       360
     PELQPRAFEP FVKSDQSDGV GLGLALVAAV ARVMGAQVRA ENRPEGGARV GFWWPEARGR       420
     DKPVR                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page