(data stored in ACNUC7421 zone)

EMBL: CP001743.PE311

CP001743.PE311       Location/Qualifiers
FT   CDS             complement(283181..283597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0315"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; InterPro
FT                   IPR002716; KEGG: gur:Gura_3493 PilT domain-containing
FT                   protein; SPTR: A7CWY2 PilT protein domain protein; PFAM:
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27093"
FT                   /protein_id="ADD27093.1"
FT                   /translation="MSSEPAPLCVLDANVLLRFITKTPLEQALRARDLLASGQQGAVRL
FT                   VLEALTLADVVYVLKKLYQMEYTEIEAALLRLFASGAVEVVERQRCESALALQVQHNID
FT                   FEDTYLAVMAQELGGRVASFDQDFKKLGVGWLQP"
     MSSEPAPLCV LDANVLLRFI TKTPLEQALR ARDLLASGQQ GAVRLVLEAL TLADVVYVLK        60
     KLYQMEYTEI EAALLRLFAS GAVEVVERQR CESALALQVQ HNIDFEDTYL AVMAQELGGR       120
     VASFDQDFKK LGVGWLQP                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page