(data stored in ACNUC7421 zone)

EMBL: CP001743.PE312

CP001743.PE312       Location/Qualifiers
FT   CDS             complement(283594..283848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0316"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; InterPro
FT                   IPR007159:IPR006339; KEGG: regulators of
FT                   stationary/sporulation gene expression protein; SPTR:
FT                   O28268 Putative uncharacterized protein; PFAM: SpoVT / AbrB
FT                   like domain; TIGRFAM: looped-hinge helix DNA binding
FT                   domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27094"
FT                   /protein_id="ADD27094.1"
FT                   /translation="MIYRTTLAARGQLTLPKEIREKFGIKEGDQINFEVTGDTIRLKVV
FT                   PRMRIEELFEQLPGATVPYPGPAKEREVMRARHARKEQR"
     MIYRTTLAAR GQLTLPKEIR EKFGIKEGDQ INFEVTGDTI RLKVVPRMRI EELFEQLPGA        60
     TVPYPGPAKE REVMRARHAR KEQR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page