(data stored in ACNUC7421 zone)

EMBL: CP001743.PE316

CP001743.PE316       Location/Qualifiers
FT   CDS             288469..289401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A8RW83 Putative
FT                   uncharacterized protein; InterPro IPR000515; COGs: COG1175
FT                   ABC-type sugar transport systems permease components; KEGG:
FT                   bha:BH1077 glycerol-3-phosphate ABC transporter (permease);
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27098"
FT                   /protein_id="ADD27098.1"
FT                   /translation="MINAKNSEQNLQNSIPMRRIGRLGEGLEVALLLVPGLLLLLVFTV
FT                   WPTLNAFWLSFHRENLLGTERDWVGLANYAEMLRDPAFWRAVGATFLFAAIVVPVQLLL
FT                   GLLAALMVARPFPGVALFRTLFFLTTAVPTAVAAVAWGWYLHPIGGTVNRWLEAVGLPA
FT                   QPWLTSPELALPTLAIVTAWAGVGFTAILLTAGLQQIPEDLYEAARIDGAGAWRQFWHI
FT                   TLPMLSPTLFLVALLTVLTSLTAFGQIHLLTRGGPMESTTVWIYRIYQDAFFNFRFSYA
FT                   AAQSVALFLVLLLLAALQFRGLGRRVHYE"
     MINAKNSEQN LQNSIPMRRI GRLGEGLEVA LLLVPGLLLL LVFTVWPTLN AFWLSFHREN        60
     LLGTERDWVG LANYAEMLRD PAFWRAVGAT FLFAAIVVPV QLLLGLLAAL MVARPFPGVA       120
     LFRTLFFLTT AVPTAVAAVA WGWYLHPIGG TVNRWLEAVG LPAQPWLTSP ELALPTLAIV       180
     TAWAGVGFTA ILLTAGLQQI PEDLYEAARI DGAGAWRQFW HITLPMLSPT LFLVALLTVL       240
     TSLTAFGQIH LLTRGGPMES TTVWIYRIYQ DAFFNFRFSY AAAQSVALFL VLLLLAALQF       300
     RGLGRRVHYE                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page