(data stored in ACNUC7421 zone)

EMBL: CP001743.PE321

CP001743.PE321       Location/Qualifiers
FT   CDS             293902..296607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0325"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; SPTR:
FT                   A6G459 WD40-like Beta Propeller protein; InterPro
FT                   IPR011659; COGs: COG0823 Periplasmic component of the Tol
FT                   biopolymer transport system; KEGG: gbm:Gbem_2492 peptidase
FT                   S9B dipeptidylpeptidase IV domain protein; PFAM: Dipeptidyl
FT                   peptidase IV (DPP IV) N-terminal region; WD40-like Beta
FT                   Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27103"
FT                   /protein_id="ADD27103.1"
FT                   /translation="MLRFLAVALLIGSLALAQFDPTQRWFTVRTEHFDIHYHSGLERVA
FT                   TEAAIYAEKAYALLLEDFEAPPGRISIVLSDVGDTLNGFANPVNNLVGIFTGQFRSSDL
FT                   FNPRLSSWWETVIFHEIAHIFDLSQVRGPLKEPTRIFGQLPAQSAVKPFPFVEGTVLYL
FT                   KHKKLGESRLNDATTRMMLRQMVLSGRFPSLDEIRQAYSRSTWPYLGFLVYNYSAWLVQ
FT                   YLEVRFGEDAYRRFTEANAGMLAFKDFNEPFLKAFGVSLDQIYADFVRWLPSQFEGEIA
FT                   RIRAEGLTPVQKLSSLGFFSEGPADSANGLVYAHASPLRSGLRIIVNENERELLNGPAQ
FT                   HPQWSPDGRYLLFTTSSATSPYFVASDLYQYDRLEGRVQRLTQGERVYYARYAPDGKSI
FT                   FLAKNTPDGSTELARYFIEFNRTQPLRSFPHQDGVIHSFAVAPDGRSLVLALLRRGGFQ
FT                   DLYRYTLETGALAPLTQDRNVDSDPVFSPDGRYVIYSSDVNRVYNLYAYRLEDGAVFQV
FT                   TNLLTGAFQPTFSHSQQQIIFSGYDETGYNLYQLPYNPSAWKRVELPREPLPAFKPAEA
FT                   ASGEPYNPFHYLRPLYWLPIAGVGVEGFGLGVSFAASDPVGLHAYAVGAGFDSSLRGVF
FT                   YDLAYQYTGLGFPLVLQAVGAGRDSAQGVGASFWSPQGSLGLQYVRLDVLEPALDPSQN
FT                   TVTHAFSLRLNGASTSASDLFRSSSSLSAVGTAFVREGSPDWRYRVQGALGFQFRLPLE
FT                   ASHLIGLRVGGGFTTSPLALDGFDLGAWPLVAGGQPLLAVRGYGPGQLRGQQALVGSLE
FT                   YRLPPWSLERGLGNWPLFFDDLSLSVFLDAGAAGSPLDLSQVRFSLGAELRLGLTLFYL
FT                   APGSSVALGGAQGFGEPGPRFYLSLVLPGL"
     MLRFLAVALL IGSLALAQFD PTQRWFTVRT EHFDIHYHSG LERVATEAAI YAEKAYALLL        60
     EDFEAPPGRI SIVLSDVGDT LNGFANPVNN LVGIFTGQFR SSDLFNPRLS SWWETVIFHE       120
     IAHIFDLSQV RGPLKEPTRI FGQLPAQSAV KPFPFVEGTV LYLKHKKLGE SRLNDATTRM       180
     MLRQMVLSGR FPSLDEIRQA YSRSTWPYLG FLVYNYSAWL VQYLEVRFGE DAYRRFTEAN       240
     AGMLAFKDFN EPFLKAFGVS LDQIYADFVR WLPSQFEGEI ARIRAEGLTP VQKLSSLGFF       300
     SEGPADSANG LVYAHASPLR SGLRIIVNEN ERELLNGPAQ HPQWSPDGRY LLFTTSSATS       360
     PYFVASDLYQ YDRLEGRVQR LTQGERVYYA RYAPDGKSIF LAKNTPDGST ELARYFIEFN       420
     RTQPLRSFPH QDGVIHSFAV APDGRSLVLA LLRRGGFQDL YRYTLETGAL APLTQDRNVD       480
     SDPVFSPDGR YVIYSSDVNR VYNLYAYRLE DGAVFQVTNL LTGAFQPTFS HSQQQIIFSG       540
     YDETGYNLYQ LPYNPSAWKR VELPREPLPA FKPAEAASGE PYNPFHYLRP LYWLPIAGVG       600
     VEGFGLGVSF AASDPVGLHA YAVGAGFDSS LRGVFYDLAY QYTGLGFPLV LQAVGAGRDS       660
     AQGVGASFWS PQGSLGLQYV RLDVLEPALD PSQNTVTHAF SLRLNGASTS ASDLFRSSSS       720
     LSAVGTAFVR EGSPDWRYRV QGALGFQFRL PLEASHLIGL RVGGGFTTSP LALDGFDLGA       780
     WPLVAGGQPL LAVRGYGPGQ LRGQQALVGS LEYRLPPWSL ERGLGNWPLF FDDLSLSVFL       840
     DAGAAGSPLD LSQVRFSLGA ELRLGLTLFY LAPGSSVALG GAQGFGEPGP RFYLSLVLPG       900
     L                                                                       901
//

If you have problems or comments...

PBIL Back to PBIL home page