(data stored in ACNUC7421 zone)

EMBL: CP001743.PE322

CP001743.PE322       Location/Qualifiers
FT   CDS             296653..297855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0326"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="TIGRFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; PFAM: adenylosuccinate
FT                   synthetase; InterPro IPR001114; SPTR: Q5SLS1
FT                   Adenylosuccinate synthetase; KEGG: Os03g0174500;
FT                   hypothetical protein ; K01939 adenylosuccinate synthase;
FT                   COGs: COG0104 Adenylosuccinate synthase; SMART:
FT                   adenylosuccinate synthetase; PFAM: Adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27104"
FT                   /protein_id="ADD27104.1"
FT                   /translation="MPGIAIIGAQWGDEGKGKVTDALAEDADFVVRYQGGANAGHTVVA
FT                   QGKTFKLNLLPTGVIHPQATNVLGDGMVIDAYRFAEEMQNIRAEGLNPRVLVSDKAHLV
FT                   LPHHKTVEARNNFVGTTKRGIGPAYSDRARRVGIRAGDLLNEAVLRERVETLLTEKPNS
FT                   TREAGWDTPEKALADLYRMREILAPHITDTGRLLREAIQQGKKVLFEGAQATLLDLNYG
FT                   DYPYVTSSHPTVGGIIVGAGVNHKAINKVYGVAKAYATRVGNGPFPTELFGEEDEYLRQ
FT                   KGGEFGVTTGRARRTGWLDLVLLKYACEVNGFDGLVLTKLDVLSGFPVVKVGVEHRPDG
FT                   SVKYAEIPGWGDLTGIQSREELPASLKQFIELVEDFTQTPVVMFSTSPRREDTFGAVSW
FT                   V"
     MPGIAIIGAQ WGDEGKGKVT DALAEDADFV VRYQGGANAG HTVVAQGKTF KLNLLPTGVI        60
     HPQATNVLGD GMVIDAYRFA EEMQNIRAEG LNPRVLVSDK AHLVLPHHKT VEARNNFVGT       120
     TKRGIGPAYS DRARRVGIRA GDLLNEAVLR ERVETLLTEK PNSTREAGWD TPEKALADLY       180
     RMREILAPHI TDTGRLLREA IQQGKKVLFE GAQATLLDLN YGDYPYVTSS HPTVGGIIVG       240
     AGVNHKAINK VYGVAKAYAT RVGNGPFPTE LFGEEDEYLR QKGGEFGVTT GRARRTGWLD       300
     LVLLKYACEV NGFDGLVLTK LDVLSGFPVV KVGVEHRPDG SVKYAEIPGW GDLTGIQSRE       360
     ELPASLKQFI ELVEDFTQTP VVMFSTSPRR EDTFGAVSWV                             400
//

If you have problems or comments...

PBIL Back to PBIL home page