(data stored in ACNUC7421 zone)

EMBL: CP001743.PE323

CP001743.PE323       Location/Qualifiers
FT   CDS             complement(297852..298334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0327"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   SPTR: A2W0X5 Putative uncharacterized protein; InterPro
FT                   IPR007214; COGs: COG2606 conserved hypothetical protein;
FT                   KEGG: gbm:Gbem_1948 YbaK/prolyl-tRNA synthetase associated
FT                   region; PFAM: YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27105"
FT                   /protein_id="ADD27105.1"
FT                   /translation="MKLSPSALKVQAALNQRGFAHLQVQELSASTRTAQEAAAAVGCAV
FT                   GQIVKSLVFRGAESARPYLLLVSGANRVDVARLEALLGEKLEKPDADYVRQVTGFAIGG
FT                   VPPVGHAQALEALVDPDLLQYERIYAAAGTPFALFGLSPEELLALTGGRVVALKSD"
     MKLSPSALKV QAALNQRGFA HLQVQELSAS TRTAQEAAAA VGCAVGQIVK SLVFRGAESA        60
     RPYLLLVSGA NRVDVARLEA LLGEKLEKPD ADYVRQVTGF AIGGVPPVGH AQALEALVDP       120
     DLLQYERIYA AAGTPFALFG LSPEELLALT GGRVVALKSD                             160
//

If you have problems or comments...

PBIL Back to PBIL home page