(data stored in ACNUC7421 zone)

EMBL: CP001743.PE325

CP001743.PE325       Location/Qualifiers
FT   CDS             299506..301347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0329"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; PRIAM:
FT                   Arginine--tRNA ligase; PFAM: DALR anticodon binding domain
FT                   protein; arginyl tRNA synthetase domain protein;
FT                   Arginyl-tRNA synthetase, class Ic, core;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR001412:IPR 001278;
FT                   KEGG: sus:Acid_5890 arginyl-tRNA synthetase; COGs: COG0018
FT                   Arginyl-tRNA synthetase; SPTR: Q72GE2 Arginyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (R); DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27107"
FT                   /protein_id="ADD27107.1"
FT                   /translation="MLASRPEIKSQLKAAIAQALEALGLQEWPEIVVQETPPDKEGDYG
FT                   TPVAMSLARTLRKAPPQIAADLLQNIQLPAWVRRTFVLGGYLNFELDPAFLVKSATLPV
FT                   APFPKVAGKVLLEHTSVNPNKELHVGHLRNICLGDSLARILRFVGRDVEVMNYIDDTGR
FT                   QAAESLYALQYFGLKEAPAQTKYDHWVGEAYVRLHQAMEDPEQKARIEQGVQSTLHRLE
FT                   AGELRDAVDKILRAQLQTMYRLGAEYNALVWESDIVREGLLGKAMKILEGSPYVSRPTE
FT                   GKYAGALVMDTSAFIPGLEDPYLVLIRSNGTSTYTAKDIALQFWKMGLLEGLRFVTYDT
FT                   QPSGAPLYSTHPEGVPLPFGGASETINVVDARQSHALRVVQASLEVEGRPDLAEKCFHL
FT                   AYETVLLEGRQMSGRKGIVVSVDEVMDEAVKRVRAVIAEKNPDHPSPAEAAEQIGVGAV
FT                   RFAMLKTEAKKQIDFRYDQALSFEGDTGPYIQYAYARAGSILRKAEEQGVIQEAPDFTQ
FT                   ATPYEVALAKTLLRFPEAVQDAARNKAPHIVAQYLLELAAAWSSFYNAKTPDGRPATPV
FT                   LSAPPELRGVRLELVKALRQTLKQGLGLLGLEAPEVM"
     MLASRPEIKS QLKAAIAQAL EALGLQEWPE IVVQETPPDK EGDYGTPVAM SLARTLRKAP        60
     PQIAADLLQN IQLPAWVRRT FVLGGYLNFE LDPAFLVKSA TLPVAPFPKV AGKVLLEHTS       120
     VNPNKELHVG HLRNICLGDS LARILRFVGR DVEVMNYIDD TGRQAAESLY ALQYFGLKEA       180
     PAQTKYDHWV GEAYVRLHQA MEDPEQKARI EQGVQSTLHR LEAGELRDAV DKILRAQLQT       240
     MYRLGAEYNA LVWESDIVRE GLLGKAMKIL EGSPYVSRPT EGKYAGALVM DTSAFIPGLE       300
     DPYLVLIRSN GTSTYTAKDI ALQFWKMGLL EGLRFVTYDT QPSGAPLYST HPEGVPLPFG       360
     GASETINVVD ARQSHALRVV QASLEVEGRP DLAEKCFHLA YETVLLEGRQ MSGRKGIVVS       420
     VDEVMDEAVK RVRAVIAEKN PDHPSPAEAA EQIGVGAVRF AMLKTEAKKQ IDFRYDQALS       480
     FEGDTGPYIQ YAYARAGSIL RKAEEQGVIQ EAPDFTQATP YEVALAKTLL RFPEAVQDAA       540
     RNKAPHIVAQ YLLELAAAWS SFYNAKTPDG RPATPVLSAP PELRGVRLEL VKALRQTLKQ       600
     GLGLLGLEAP EVM                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page