(data stored in ACNUC7421 zone)

EMBL: CP001743.PE327

CP001743.PE327       Location/Qualifiers
FT   CDS             302527..303726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1406 transcriptional activator
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27109"
FT                   /protein_id="ADD27109.1"
FT                   /translation="MVERSSYGEDPRLILELRSHYPAERTRYITLPPLSWAEARASMLS
FT                   NLPFAQAARLFLASGGSPGHLRELLAVPHNGTEMPLPQRVRAQVQLESRMLSLEARLAL
FT                   ERLSVHPGPYSQGLLDALEATPYLDELERRGWLIYAGQWQFSDDASRRVLYLGLQPGRR
FT                   QQYHRQAALQCAMEEQRMAEAYHRLMAGDTADWGTFVNTLPGWTRYGLKAWLGMHENLP
FT                   MGPSTGEAARGSELALLEEARFGQGFEVEGRHVRWMRTPSMSSASGIIWAAHDEPSLLH
FT                   LKGNAYVENPLGVGISGRAAPLMLEIQEPREARIIFLPGIQAGALADNALLLPLQEELD
FT                   VWFRVPAGASIRLTSSAESGLIDLEVTSYRVAPPPLAQSAPRVEVFEFFRSAVEAARKS
FT                   "
     MVERSSYGED PRLILELRSH YPAERTRYIT LPPLSWAEAR ASMLSNLPFA QAARLFLASG        60
     GSPGHLRELL AVPHNGTEMP LPQRVRAQVQ LESRMLSLEA RLALERLSVH PGPYSQGLLD       120
     ALEATPYLDE LERRGWLIYA GQWQFSDDAS RRVLYLGLQP GRRQQYHRQA ALQCAMEEQR       180
     MAEAYHRLMA GDTADWGTFV NTLPGWTRYG LKAWLGMHEN LPMGPSTGEA ARGSELALLE       240
     EARFGQGFEV EGRHVRWMRT PSMSSASGII WAAHDEPSLL HLKGNAYVEN PLGVGISGRA       300
     APLMLEIQEP REARIIFLPG IQAGALADNA LLLPLQEELD VWFRVPAGAS IRLTSSAESG       360
     LIDLEVTSYR VAPPPLAQSA PRVEVFEFFR SAVEAARKS                              399
//

If you have problems or comments...

PBIL Back to PBIL home page