(data stored in ACNUC7421 zone)

EMBL: CP001743.PE328

CP001743.PE328       Location/Qualifiers
FT   CDS             complement(303780..304040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0332"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; SPTR: A4KL94
FT                   Hypothetical glutaredoxin protein; InterPro
FT                   IPR006662:IPR002109:IPR008554; COGs: COG0695 Glutaredoxin
FT                   and related protein; KEGG: aba:Acid345_2784 glutaredoxin;
FT                   PFAM: Glutaredoxin; TIGRFAM: Glutaredoxin-like protein,
FT                   YruB-family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27110"
FT                   /protein_id="ADD27110.1"
FT                   /translation="MITMYTTSWCPDCHAAKQALTSLGLPFQEVNIEHDPTAAELVMKV
FT                   NNGKRSVPTLVYKEHATSLSRFSISKLKAWMEQVGLQAGQP"
     MITMYTTSWC PDCHAAKQAL TSLGLPFQEV NIEHDPTAAE LVMKVNNGKR SVPTLVYKEH        60
     ATSLSRFSIS KLKAWMEQVG LQAGQP                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page