(data stored in ACNUC7421 zone)

EMBL: CP001743.PE329

CP001743.PE329       Location/Qualifiers
FT   CDS             304181..304987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0333"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PRIAM:
FT                   DNA-formamidopyrimidine glycosylase; PFAM: DNA
FT                   glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; zinc finger Fpg domain protein;
FT                   InterProIPR012319:IPR010663:IPR015886:IPR000214:IPR 000191;
FT                   KEGG: tcx:Tcr_1921 formamidopyrimidine-DNA glycosylase;
FT                   COGs: COG0266 Formamidopyrimidine-DNA glycosylase; SPTR:
FT                   O50606 Formamidopyrimidine-DNA glycosylase; PFAM: Zinc
FT                   finger found in FPG and IleRS; Formamidopyrimidine-DNA
FT                   glycosylase N-terminal domain; Formamidopyrimidine-DNA
FT                   glycosylase H2TH domain; TIGRFAM: formamidopyrimidine-DNA
FT                   glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27111"
FT                   /protein_id="ADD27111.1"
FT                   /translation="MPELPEVETTRRILEPYLLGQRIQQLLHQDPARYRNTERAEGRRV
FT                   LGTSRRGKYLIIHLDENLELIVHLGMTGGFRFEPHRHTRVTLHLPHQTLYYTDPRRFGK
FT                   WWVVEAGDYREIDLLCRMGPEPLSDDFTLAHFQQALRTPRKIKEVLLAQEAVAGVGNIY
FT                   ADESLWLSQIHPERPAASLSSPEVRRLYKAIRVVMERAVEAGGSTLSDASYRQPDGQPG
FT                   YFQFQHNAYDRTGQPCKRKGCTGRIAKIVVGGRGTHFCPQCQQNSR"
     MPELPEVETT RRILEPYLLG QRIQQLLHQD PARYRNTERA EGRRVLGTSR RGKYLIIHLD        60
     ENLELIVHLG MTGGFRFEPH RHTRVTLHLP HQTLYYTDPR RFGKWWVVEA GDYREIDLLC       120
     RMGPEPLSDD FTLAHFQQAL RTPRKIKEVL LAQEAVAGVG NIYADESLWL SQIHPERPAA       180
     SLSSPEVRRL YKAIRVVMER AVEAGGSTLS DASYRQPDGQ PGYFQFQHNA YDRTGQPCKR       240
     KGCTGRIAKI VVGGRGTHFC PQCQQNSR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page