(data stored in ACNUC7421 zone)

EMBL: CP001743.PE33

CP001743.PE33        Location/Qualifiers
FT   CDS             complement(29759..30421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0034"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: psa:PST_2709
FT                   probable two-component response regulator; COGs: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; SPTR: A5XX47
FT                   DNA-binding response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26815"
FT                   /protein_id="ADD26815.1"
FT                   /translation="MRLLLVEDEPNIARPVLRALEAQGHQVRHAPDLTTARALLAEAEP
FT                   DLMILDVRLPESEDGGFILAREARAAGYKGPILFMTARDALADRVMGLDEGGDDYVVKP
FT                   FDLPELLARVRALLRRMSEVKQSRVQLGPLELDLADRSVRWEGRLVELSGREYALLERL
FT                   ALFPGRVYSPEELLDLIWGEEASDTGVVKVCVHHLRNKLDSRVVRTVPGGYRLGVEP"
     MRLLLVEDEP NIARPVLRAL EAQGHQVRHA PDLTTARALL AEAEPDLMIL DVRLPESEDG        60
     GFILAREARA AGYKGPILFM TARDALADRV MGLDEGGDDY VVKPFDLPEL LARVRALLRR       120
     MSEVKQSRVQ LGPLELDLAD RSVRWEGRLV ELSGREYALL ERLALFPGRV YSPEELLDLI       180
     WGEEASDTGV VKVCVHHLRN KLDSRVVRTV PGGYRLGVEP                             220
//

If you have problems or comments...

PBIL Back to PBIL home page