(data stored in ACNUC7421 zone)

EMBL: CP001743.PE331

CP001743.PE331       Location/Qualifiers
FT   CDS             complement(305364..306329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0335"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; SPTR: A0ACG9 Putative
FT                   transcriptional regulator; InterPro IPR001034:IPR013196;
FT                   COGs: COG2378 transcriptional regulator protein; KEGG:
FT                   aba:Acid345_4546 transcriptional regulator, DeoR family;
FT                   PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27113"
FT                   /protein_id="ADD27113.1"
FT                   /translation="MRADRLVSILLLLQTRGRATTAELAKRLEVSPRTIHRDMEALTAS
FT                   GVPVYAERGSKGGWRLLEEYRTNLTGLSQPEIMALFALKPTQLLRDLGLGKAGENALIK
FT                   MLAALPAAQRRGAEYARQRILVDIQRYQEKVPLLPVLQEAVWQDRKLRLVYEPMEGQPA
FT                   ERTVDPLGLVVKGSVWYLVASRQGELRSYRVSRILEASVLDEPSQRPADFDLEAYWHKA
FT                   RADFRAKIPSYRIWVRVQEKVLARSNPASHWGQLEHCKPAGDSWLKAQIRFEYPEQALG
FT                   WVLAAGAGVEALEPLEFRKQVLEALSKALALYQTQARPVS"
     MRADRLVSIL LLLQTRGRAT TAELAKRLEV SPRTIHRDME ALTASGVPVY AERGSKGGWR        60
     LLEEYRTNLT GLSQPEIMAL FALKPTQLLR DLGLGKAGEN ALIKMLAALP AAQRRGAEYA       120
     RQRILVDIQR YQEKVPLLPV LQEAVWQDRK LRLVYEPMEG QPAERTVDPL GLVVKGSVWY       180
     LVASRQGELR SYRVSRILEA SVLDEPSQRP ADFDLEAYWH KARADFRAKI PSYRIWVRVQ       240
     EKVLARSNPA SHWGQLEHCK PAGDSWLKAQ IRFEYPEQAL GWVLAAGAGV EALEPLEFRK       300
     QVLEALSKAL ALYQTQARPV S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page