(data stored in ACNUC7421 zone)

EMBL: CP001743.PE333

CP001743.PE333       Location/Qualifiers
FT   CDS             307618..308586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0337"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; PRIAM:
FT                   D-alanine--D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; protein of unknown
FT                   function DUF201;
FT                   InterProIPR003135:IPR011095:IPR003806:IPR011127:IPR
FT                   011761:IPR000291:IPR005905; KEGG: pst:PSPTO_4182
FT                   D-alanyl-alanine synthetase A; COGs: COG1181
FT                   D-alanine-D-alanine ligase and related ATP-grasp protein;
FT                   SPTR: Q72IA9 D-alanine--D-alanine ligase; PFAM: ATP-grasp
FT                   domain; D-ala D-ala ligase N-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27115"
FT                   /protein_id="ADD27115.1"
FT                   /translation="MKVLLLAGGPPGEHEVSLSSARGVLAAMPHPTELVVIAKDGRWLL
FT                   GEDAYEALRAGVAEQGTHPFPPPVPWQHYDVVFPLLHGPLGEDGVIQGFLQLLRRPYVG
FT                   AGVASSALCMDKDLCKRVLRQAGIPVVPWVTLYKGEPTPQPPFPPPYFVKPANTGSSVG
FT                   ISKVKADQDATRALAEAFAWDDKVLVEQGIEGVRELEVALLGNIHAEASVVGEITYQSE
FT                   FYDYETKYTEGKAQLHLPAPIPPELSDEIRATALEAYRILGVRGMARVDFFLSPQGELY
FT                   LNEFNTIPGFTPTSMYPKLWQATGLAYPDLLDRLVRLALER"
     MKVLLLAGGP PGEHEVSLSS ARGVLAAMPH PTELVVIAKD GRWLLGEDAY EALRAGVAEQ        60
     GTHPFPPPVP WQHYDVVFPL LHGPLGEDGV IQGFLQLLRR PYVGAGVASS ALCMDKDLCK       120
     RVLRQAGIPV VPWVTLYKGE PTPQPPFPPP YFVKPANTGS SVGISKVKAD QDATRALAEA       180
     FAWDDKVLVE QGIEGVRELE VALLGNIHAE ASVVGEITYQ SEFYDYETKY TEGKAQLHLP       240
     APIPPELSDE IRATALEAYR ILGVRGMARV DFFLSPQGEL YLNEFNTIPG FTPTSMYPKL       300
     WQATGLAYPD LLDRLVRLAL ER                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page