(data stored in ACNUC7421 zone)

EMBL: CP001743.PE334

CP001743.PE334       Location/Qualifiers
FT   CDS             309148..309357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27116"
FT                   /protein_id="ADD27116.1"
FT                   /translation="MVTGDRGYRSWALKAQVAWRKECFLRGHRLVGVVLLGYGLLRLME
FT                   RDPTWRLLVGQFREIWLFRIGVYF"
     MVTGDRGYRS WALKAQVAWR KECFLRGHRL VGVVLLGYGL LRLMERDPTW RLLVGQFREI        60
     WLFRIGVYF                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page