(data stored in ACNUC7421 zone)

EMBL: CP001743.PE337

CP001743.PE337       Location/Qualifiers
FT   CDS             312463..313026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0341"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; InterPro IPR000792;
FT                   KEGG: afw:Anae109_0915 two component LuxR family
FT                   transcriptional regulator; SMART: regulatory protein LuxR;
FT                   PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27119"
FT                   /protein_id="ADD27119.1"
FT                   /translation="MIRVLSGSRLIQESLTLALGNLLLRRAVVLVADYPLGSALALLPG
FT                   VQGPCVVKTASDSPYYLSDLVALGPAGLVLEGAGLDFLRWTLQQVSEGQRVLPRLGEVG
FT                   LTRKERAVLRLLVGGVCNDAISAHLGISPRRTANLVSTVKRALGAETRADVVLRYFGLA
FT                   PEPIIKATLQKTGNFSLPHEVETA"
     MIRVLSGSRL IQESLTLALG NLLLRRAVVL VADYPLGSAL ALLPGVQGPC VVKTASDSPY        60
     YLSDLVALGP AGLVLEGAGL DFLRWTLQQV SEGQRVLPRL GEVGLTRKER AVLRLLVGGV       120
     CNDAISAHLG ISPRRTANLV STVKRALGAE TRADVVLRYF GLAPEPIIKA TLQKTGNFSL       180
     PHEVETA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page