(data stored in ACNUC7421 zone)

EMBL: CP001743.PE34

CP001743.PE34        Location/Qualifiers
FT   CDS             30591..31055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_02263 protein GlcG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26816"
FT                   /protein_id="ADD26816.1"
FT                   /translation="MNKTLKTLLVVSSLAVAGAFAQQTPAPQPTPMQPRAMQRMAAPKG
FT                   LIGNLYWSAAQFLGVTPAELAVLSGGTKTLAQVATDLGKTPAALEAALVTARNQAIDQA
FT                   VQAGRLTAEQANTLKASSQAVAKAFVAQPVQLRMGLGGRGDWDGPRGRGR"
     MNKTLKTLLV VSSLAVAGAF AQQTPAPQPT PMQPRAMQRM AAPKGLIGNL YWSAAQFLGV        60
     TPAELAVLSG GTKTLAQVAT DLGKTPAALE AALVTARNQA IDQAVQAGRL TAEQANTLKA       120
     SSQAVAKAFV AQPVQLRMGL GGRGDWDGPR GRGR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page