(data stored in ACNUC7421 zone)

EMBL: CP001743.PE340

CP001743.PE340       Location/Qualifiers
FT   CDS             316317..318830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0345"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; InterPro
FT                   IPR001440:IPR013026; KEGG: glo:Glov_2533 TPR
FT                   repeat-containing protein; COGs: COG3629 DNA-binding
FT                   transcriptional activator of the SARP family; SPTR: B5IGG0
FT                   Archaeal ATPase family; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27122"
FT                   /protein_id="ADD27122.1"
FT                   /translation="MSVLSPSALELLATAPAVVVAPVGIGFAQTDLEAWAHKTRRRILR
FT                   DPAEFSGLAPTLILPQRRSDLERLNSSDPRDFLFLRESDLLFSHDEWQQAVSTQQTYAE
FT                   TGGWPEALALLQRIVLQPGESLVRHPLCVARLGSLLPKDIPREILAKAAQSPLLIPELY
FT                   GLLGLDDTSVAELYDRGLLYAQGSGLAMPKLLRLYLRGSIPAEVARFIEITLLASGHVT
FT                   AVLELLAEQGEWERYLRLLTETFSTALGNAYLREWLALVPPKYRDLPVYRYLATYLARF
FT                   AGHTTLMEKELVELLPLADDHLRPFVLNAYGVSLGMQARYEEAIEKFRECLESNSSRVE
FT                   GITGKVFHNLGVAFFHLGKLAQAQDALLRAASIYRQLGLFDQEAISLATLAPVELCLGN
FT                   PREAISLVERALPYMNKLAAESYLTAENLAKAWIMCGDISNAERHLLELPEPKRDLRSH
FT                   LVTKKRLGEVYLWKGRYAEAKQLVEEVLYSNFKDQEVLDDVHLLLSRIAFLEGKTEQAR
FT                   AHLNKVVRSVHAITESAWQGLINLDTAIAELRRLGMKFDLARLLLRKGDLASLREALEL
FT                   SRTYQYGLLLHHPHYAHLWRPLVLADKGARSVFPLQIGTFGSFEARLLGTKLDLSRFKT
FT                   RKSAVLLTYMALHPSAHNRDKLAELFWSDVSNPLASLNTAVSELRKLFDAPIMEGNKGQ
FT                   VWLAFPVQTDLADFTKSTEPFLKQPLLDPNQIGRLEAQLARFDAPWLPDFPDWFDEERT
FT                   FVEHRKAKLWRLLADFYATRAPHKAVAAYQRVTCLEPFNAEAWAGLMELYNTLGEKSLA
FT                   EQAQAAMHRAMRELFPFEPILCNQK"
     MSVLSPSALE LLATAPAVVV APVGIGFAQT DLEAWAHKTR RRILRDPAEF SGLAPTLILP        60
     QRRSDLERLN SSDPRDFLFL RESDLLFSHD EWQQAVSTQQ TYAETGGWPE ALALLQRIVL       120
     QPGESLVRHP LCVARLGSLL PKDIPREILA KAAQSPLLIP ELYGLLGLDD TSVAELYDRG       180
     LLYAQGSGLA MPKLLRLYLR GSIPAEVARF IEITLLASGH VTAVLELLAE QGEWERYLRL       240
     LTETFSTALG NAYLREWLAL VPPKYRDLPV YRYLATYLAR FAGHTTLMEK ELVELLPLAD       300
     DHLRPFVLNA YGVSLGMQAR YEEAIEKFRE CLESNSSRVE GITGKVFHNL GVAFFHLGKL       360
     AQAQDALLRA ASIYRQLGLF DQEAISLATL APVELCLGNP REAISLVERA LPYMNKLAAE       420
     SYLTAENLAK AWIMCGDISN AERHLLELPE PKRDLRSHLV TKKRLGEVYL WKGRYAEAKQ       480
     LVEEVLYSNF KDQEVLDDVH LLLSRIAFLE GKTEQARAHL NKVVRSVHAI TESAWQGLIN       540
     LDTAIAELRR LGMKFDLARL LLRKGDLASL REALELSRTY QYGLLLHHPH YAHLWRPLVL       600
     ADKGARSVFP LQIGTFGSFE ARLLGTKLDL SRFKTRKSAV LLTYMALHPS AHNRDKLAEL       660
     FWSDVSNPLA SLNTAVSELR KLFDAPIMEG NKGQVWLAFP VQTDLADFTK STEPFLKQPL       720
     LDPNQIGRLE AQLARFDAPW LPDFPDWFDE ERTFVEHRKA KLWRLLADFY ATRAPHKAVA       780
     AYQRVTCLEP FNAEAWAGLM ELYNTLGEKS LAEQAQAAMH RAMRELFPFE PILCNQK          837
//

If you have problems or comments...

PBIL Back to PBIL home page