(data stored in ACNUC7421 zone)

EMBL: CP001743.PE342

CP001743.PE342       Location/Qualifiers
FT   CDS             complement(320274..320702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0347"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; SPTR: A0YQB3 Putative
FT                   uncharacterized protein; InterPro IPR009288; COGs: COG2105
FT                   conserved hypothetical protein; KEGG: stm:STM4411 putative
FT                   cytoplasmic protein; PFAM: AIG2-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27124"
FT                   /protein_id="ADD27124.1"
FT                   /translation="MNAPEAVFVYGTLKQGERNFQVSKAAGWLRSAEAYIEGFRLFHIP
FT                   RSEVRPYAYPGVVRGEGRVWGEVQWFADLAHALELLDELEDEGREYRRISATAYLSQQA
FT                   PQPCAVWVYTYPSLEAMRSVSGLWLPEGVWREQTQPKG"
     MNAPEAVFVY GTLKQGERNF QVSKAAGWLR SAEAYIEGFR LFHIPRSEVR PYAYPGVVRG        60
     EGRVWGEVQW FADLAHALEL LDELEDEGRE YRRISATAYL SQQAPQPCAV WVYTYPSLEA       120
     MRSVSGLWLP EGVWREQTQP KG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page