(data stored in ACNUC7421 zone)

EMBL: CP001743.PE351

CP001743.PE351       Location/Qualifiers
FT   CDS             complement(332280..333395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0356"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PRIAM: Glutamine--scyllo-inositol transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase; Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; InterPro
FT                   IPR000653:IPR001597:IPR000277; KEGG: aeh:Mlg_0663
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; COGs: COG0399
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; SPTR: P15263
FT                   Pleiotropic regulatory protein; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27133"
FT                   /protein_id="ADD27133.1"
FT                   /translation="MSTLTQIPILDLKAEVDELWDELNAAIQRVLRSTQFIMGPEVQAL
FT                   EQQLAQYLGVKHAVALNSGTDALVIGLRALGVGPGDEVITSPFTFFATAEAISLLGARP
FT                   VFVDIDPQSFNLDPAGLEAAISPQTRAIIPVHLYGNPAAMGPILEIARRHGLKVLEDCA
FT                   QSFGARYEPLHRFTGTLGDAGAFSFFPSKNLGAYGDGGLLVTADDAVAEQARMLRAHGS
FT                   RKKYHNEVVGYNSRLDTLQAAILLVKLPHLERYNQARRAIAQRYNEGLAGLEGLIPPAL
FT                   TPGHVFHQYTVRILGNRRDAVQARLAELGIGTMVYYPVPLHRLPIYQPLGLHLPESERA
FT                   AAEVLSLPIWPQMQPEAQRAVIEAVRAAVQG"
     MSTLTQIPIL DLKAEVDELW DELNAAIQRV LRSTQFIMGP EVQALEQQLA QYLGVKHAVA        60
     LNSGTDALVI GLRALGVGPG DEVITSPFTF FATAEAISLL GARPVFVDID PQSFNLDPAG       120
     LEAAISPQTR AIIPVHLYGN PAAMGPILEI ARRHGLKVLE DCAQSFGARY EPLHRFTGTL       180
     GDAGAFSFFP SKNLGAYGDG GLLVTADDAV AEQARMLRAH GSRKKYHNEV VGYNSRLDTL       240
     QAAILLVKLP HLERYNQARR AIAQRYNEGL AGLEGLIPPA LTPGHVFHQY TVRILGNRRD       300
     AVQARLAELG IGTMVYYPVP LHRLPIYQPL GLHLPESERA AAEVLSLPIW PQMQPEAQRA       360
     VIEAVRAAVQ G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page