(data stored in ACNUC7421 zone)

EMBL: CP001743.PE353

CP001743.PE353       Location/Qualifiers
FT   CDS             complement(333972..334916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0358"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; SPTR: A3SJ11 MviM protein; InterPro
FT                   IPR000683:IPR004104; COGs: COG0673 dehydrogenase and
FT                   related protein; KEGG: glo:Glov_1510 oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27135"
FT                   /protein_id="ADD27135.1"
FT                   /translation="MKNFALIGAAGYIAPRHLKAIKDTGNRLVAALDPFDSVGIMDSYF
FT                   PEAEFFTQPELFEDYLYRLRGTPQQVDYVSIASPNYLHNAHIRMALRAGADAICEKPLV
FT                   LNPEEIRELKDLEAETGRRVWTILQLRTHEALLSLHARLQAQPPRKYQLDLTYITSRGT
FT                   WYLRSWKGRTEQSGGLATNIGVHFFDMLTWLFGKVEQVEVHRRDDTVASGYLELERAQV
FT                   RWFLSIDVEYVPPALRAQGKRTYRSMRLDGEEIEFSEGFTELHTRVYERTLAGQGFGLE
FT                   DTYEAIATVARIRTLPLSDRTATMHPFLQKVKQ"
     MKNFALIGAA GYIAPRHLKA IKDTGNRLVA ALDPFDSVGI MDSYFPEAEF FTQPELFEDY        60
     LYRLRGTPQQ VDYVSIASPN YLHNAHIRMA LRAGADAICE KPLVLNPEEI RELKDLEAET       120
     GRRVWTILQL RTHEALLSLH ARLQAQPPRK YQLDLTYITS RGTWYLRSWK GRTEQSGGLA       180
     TNIGVHFFDM LTWLFGKVEQ VEVHRRDDTV ASGYLELERA QVRWFLSIDV EYVPPALRAQ       240
     GKRTYRSMRL DGEEIEFSEG FTELHTRVYE RTLAGQGFGL EDTYEAIATV ARIRTLPLSD       300
     RTATMHPFLQ KVKQ                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page