(data stored in ACNUC7421 zone)

EMBL: CP001743.PE355

CP001743.PE355       Location/Qualifiers
FT   CDS             complement(336254..337492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0360"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; SPTR: A6CP41
FT                   Putative uncharacterized protein; InterPro IPR001296; COGs:
FT                   COG0438 Glycosyltransferase; KEGG: aba:Acid345_3305
FT                   glycosyl transferase, group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27137"
FT                   /protein_id="ADD27137.1"
FT                   /translation="MRFLFLTQYFPPEIGAAQVRLASVIRELVRLGHQVEVVTAMPNYP
FT                   TGRVFEGYRGRLWLEEDWEGVRVVRTWLYPAMGTGPKRLLNYFSFVLSALGGVLKVQKP
FT                   DYIFVESPPLFLSLTGYLASRRFGVPFIFNIADLWPDSVRQLGLMKEGPLLCLAEGLES
FT                   WSYRQAHFITAVTEGIQKVLLEEKKVPPHKILYLPNGVDTDLFKPMPPDLALARELGLE
FT                   GKKIILYAGNHGYAHGLEVALQAARLLTDPQVVLVLIGDGSEKPRLKQMAQEMGLTNVR
FT                   FLDPKPPAYIAQLYSLAVAGLSTLRNSPLFEMTRPVKIFAGMSCAKPILYAGQGEGARL
FT                   VEGARAGLVSLPEDAQTLAHNIMAVVQNPHLAEQLGQNGRRYVETHLSWSVLIENWLYQ
FT                   LQSQQPKAEKVPV"
     MRFLFLTQYF PPEIGAAQVR LASVIRELVR LGHQVEVVTA MPNYPTGRVF EGYRGRLWLE        60
     EDWEGVRVVR TWLYPAMGTG PKRLLNYFSF VLSALGGVLK VQKPDYIFVE SPPLFLSLTG       120
     YLASRRFGVP FIFNIADLWP DSVRQLGLMK EGPLLCLAEG LESWSYRQAH FITAVTEGIQ       180
     KVLLEEKKVP PHKILYLPNG VDTDLFKPMP PDLALARELG LEGKKIILYA GNHGYAHGLE       240
     VALQAARLLT DPQVVLVLIG DGSEKPRLKQ MAQEMGLTNV RFLDPKPPAY IAQLYSLAVA       300
     GLSTLRNSPL FEMTRPVKIF AGMSCAKPIL YAGQGEGARL VEGARAGLVS LPEDAQTLAH       360
     NIMAVVQNPH LAEQLGQNGR RYVETHLSWS VLIENWLYQL QSQQPKAEKV PV               412
//

If you have problems or comments...

PBIL Back to PBIL home page