(data stored in ACNUC7421 zone)

EMBL: CP001743.PE356

CP001743.PE356       Location/Qualifiers
FT   CDS             complement(337744..338769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: P94576 Uncharacterized protein ywoF; InterPro
FT                   IPR010916; KEGG: pna:Pnap_3111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27138"
FT                   /protein_id="ADD27138.1"
FT                   /translation="MFGIPSGPTYYVSPSGSNANDGSRERPWATLSFAVQKLKPGDVLR
FT                   VLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQGNLFGIDVRGSYVDIVGFEVTN
FT                   ATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGINASQPNAGNTSILSNLVHDIGDLT
FT                   AGPCTRIHGIYQGSPKGIIQNNIIYRARGFGITTWQAATAVVMTHNLSFANLYGGISVG
FT                   SGENTLGNKAENFLVANNIVVSNPRGISEENNTGVNRFLNNLVWNNTTNWALLTSSQQN
FT                   SLTEDPRFVNFKADGSGNYYLSNDSPAIDKGIREAAPSFDFMGHPRILGIAPDLGPLET
FT                   R"
     MFGIPSGPTY YVSPSGSNAN DGSRERPWAT LSFAVQKLKP GDVLRVLPGS YNESVQVTAS        60
     GTSSQRITIA SDIRWGAKLN AQGNLFGIDV RGSYVDIVGF EVTNATNSGI ISWAPYNRFL       120
     FNHVYGIRAQ CDSNGGAGIN ASQPNAGNTS ILSNLVHDIG DLTAGPCTRI HGIYQGSPKG       180
     IIQNNIIYRA RGFGITTWQA ATAVVMTHNL SFANLYGGIS VGSGENTLGN KAENFLVANN       240
     IVVSNPRGIS EENNTGVNRF LNNLVWNNTT NWALLTSSQQ NSLTEDPRFV NFKADGSGNY       300
     YLSNDSPAID KGIREAAPSF DFMGHPRILG IAPDLGPLET R                           341
//

If you have problems or comments...

PBIL Back to PBIL home page