(data stored in ACNUC7421 zone)

EMBL: CP001743.PE358

CP001743.PE358       Location/Qualifiers
FT   CDS             340098..341528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0363"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; SPTR:
FT                   A3CTD1 Polysaccharide biosynthesis protein; InterPro
FT                   IPR002797; COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; KEGG: reh:H16_B0030
FT                   O-antigen translocase; PFAM: Polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27140"
FT                   /protein_id="ADD27140.1"
FT                   /translation="MTRIKGFLTQTSFVGNAALLASSTVLGQGLVVLVQPLLTRIYRPE
FT                   DFGWWALYGSILSLAAVMINLRYEQAIQLPREEPEARGLLLIAVGVGLGLSLLIGGVFW
FT                   FFRDVFSVWLGVQIPGWFAALVGVGLACIALMQSGSMWALRLQRFGALAQTKFQQGLWQ
FT                   ALAQVGLGLLVKGPAGLLLGDVLGRLGGVQALWRLLPRSLEGITWRTLQQTARRYRSFL
FT                   VFGTSAALLTAASFHLPFILLTAFFGAAAMGQFSLSYRITTIPVTLVAQSIGQVFFARA
FT                   AAARETPELAQLTIRTSTMLIAVGLPIFGALFVVAPQAFPLIFGSNWYEAGVYARLLAP
FT                   YLLLSIVAQPLSTLLTVKEWQQALLVFTVFELALRMGAIYWGIAIQQMYWAVFLFASSS
FT                   ALVAGISLGLFFRAAGARWADFGRGLRRYIWLNLPALLLLWGLTHWVAGWSLLGLTVLV
FT                   SATVLFFTARELRKEGLV"
     MTRIKGFLTQ TSFVGNAALL ASSTVLGQGL VVLVQPLLTR IYRPEDFGWW ALYGSILSLA        60
     AVMINLRYEQ AIQLPREEPE ARGLLLIAVG VGLGLSLLIG GVFWFFRDVF SVWLGVQIPG       120
     WFAALVGVGL ACIALMQSGS MWALRLQRFG ALAQTKFQQG LWQALAQVGL GLLVKGPAGL       180
     LLGDVLGRLG GVQALWRLLP RSLEGITWRT LQQTARRYRS FLVFGTSAAL LTAASFHLPF       240
     ILLTAFFGAA AMGQFSLSYR ITTIPVTLVA QSIGQVFFAR AAAARETPEL AQLTIRTSTM       300
     LIAVGLPIFG ALFVVAPQAF PLIFGSNWYE AGVYARLLAP YLLLSIVAQP LSTLLTVKEW       360
     QQALLVFTVF ELALRMGAIY WGIAIQQMYW AVFLFASSSA LVAGISLGLF FRAAGARWAD       420
     FGRGLRRYIW LNLPALLLLW GLTHWVAGWS LLGLTVLVSA TVLFFTAREL RKEGLV           476
//

If you have problems or comments...

PBIL Back to PBIL home page