(data stored in ACNUC7421 zone)

EMBL: CP001743.PE36

CP001743.PE36        Location/Qualifiers
FT   CDS             31522..32235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0037"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; SPTR:
FT                   A3VF44 Putative protocatechuate dioxygenase; InterPro
FT                   IPR000627:IPR002052:IPR006311; COGs: COG3485
FT                   Protocatechuate 3 4-dioxygenase beta subunit; KEGG:
FT                   noc:Noc_2416 intradiol ring-cleavage dioxygenase; PFAM:
FT                   Dioxygenase; TIGRFAM: Tat (twin-arginine translocation)
FT                   pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26818"
FT                   /protein_id="ADD26818.1"
FT                   /translation="MDNDDKPIGTILNRRKVLAALGLGGLAGVGGLMNGQRAAAQNNAL
FT                   PSCIVRPALTEGPYFVDVQLNRSDIRSDPTTGVVKPGVPLSLRFVVSRVSASGCTPLPG
FT                   AMVDIWQCDAQGLYSGVQDRFADTRGQKWLRGYQITDAQGVAQFTTIYPGWYPGRTVHI
FT                   HFKIRYQNRDFTSQLFFDDALSDRIFANPPYVKTGTRTRNANDSIYRNGGSQLLLNLTQ
FT                   SGQGYAATFDIGLNL"
     MDNDDKPIGT ILNRRKVLAA LGLGGLAGVG GLMNGQRAAA QNNALPSCIV RPALTEGPYF        60
     VDVQLNRSDI RSDPTTGVVK PGVPLSLRFV VSRVSASGCT PLPGAMVDIW QCDAQGLYSG       120
     VQDRFADTRG QKWLRGYQIT DAQGVAQFTT IYPGWYPGRT VHIHFKIRYQ NRDFTSQLFF       180
     DDALSDRIFA NPPYVKTGTR TRNANDSIYR NGGSQLLLNL TQSGQGYAAT FDIGLNL          237
//

If you have problems or comments...

PBIL Back to PBIL home page