(data stored in ACNUC7421 zone)

EMBL: CP001743.PE363

CP001743.PE363       Location/Qualifiers
FT   CDS             347557..348747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0368"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; SPTR: A7K3E6 Pilin glycosylation protein; PRIAM:
FT                   Glutamine--scyllo-inositol transaminase; COGs: COG0399
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; InterPro
FT                   IPR000653:IPR001597; KEGG: sat:SYN_02688 UDP-bacillosamine
FT                   synthetase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27145"
FT                   /protein_id="ADD27145.1"
FT                   /translation="MLKEPFIAVPFAPWPYFAPDEIEAATKVLQSGKVNYWTGQEGRLF
FT                   EREFADYVGTKHAIALHNGTVALELALYAMGVGEGDEVITTPRTFIASASAAVMRGARP
FT                   VFADVDPESGLITAETIERAITPRTKAIIVVHLAGWPADMDAIMALAHKHNLWVIEDCA
FT                   QAHGARYKGRSVGSIGHAGAWSFCQDKILTTGGEGGMLTLNDDELWSKAWSFKDHGKSY
FT                   DAVYNRQHPPGFRWLHEDFGTNWRMLEVQSAIGRVILRKLDGWVEQRRANAHYLSERFR
FT                   QIPALRVPEVPAHLHHAYYKYYVYVRPERLKPGWSRDRIMQAVSELGIPCMSGSCSEIY
FT                   LEKAFTRRGWQPAERLPVARELGETSLMFLVHPTLGQAQMQATADAVERVMEQASI"
     MLKEPFIAVP FAPWPYFAPD EIEAATKVLQ SGKVNYWTGQ EGRLFEREFA DYVGTKHAIA        60
     LHNGTVALEL ALYAMGVGEG DEVITTPRTF IASASAAVMR GARPVFADVD PESGLITAET       120
     IERAITPRTK AIIVVHLAGW PADMDAIMAL AHKHNLWVIE DCAQAHGARY KGRSVGSIGH       180
     AGAWSFCQDK ILTTGGEGGM LTLNDDELWS KAWSFKDHGK SYDAVYNRQH PPGFRWLHED       240
     FGTNWRMLEV QSAIGRVILR KLDGWVEQRR ANAHYLSERF RQIPALRVPE VPAHLHHAYY       300
     KYYVYVRPER LKPGWSRDRI MQAVSELGIP CMSGSCSEIY LEKAFTRRGW QPAERLPVAR       360
     ELGETSLMFL VHPTLGQAQM QATADAVERV MEQASI                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page