(data stored in ACNUC7421 zone)

EMBL: CP001743.PE364

CP001743.PE364       Location/Qualifiers
FT   CDS             348828..350333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; SPTR: A0YZB2 Putative
FT                   sugar nucleotide epimerase dehydratase protein;
FT                   InterProIPR013120:IPR002225:IPR003869:IPR005913:IPR 001509;
FT                   COGs: COG0451 Nucleoside-diphosphate-sugar epimerase; KEGG:
FT                   mgm:Mmc1_2166 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27146"
FT                   /protein_id="ADD27146.1"
FT                   /translation="MVAGSFAVAMVIHLLWAYRGAADAVLLGAYAQIYAKNVGILMLIA
FT                   FVVFAASGFYSRGRAYQSRYKMLVVAQAVLLAYLIFGFAVFMLPLVDPPRSVLFASGFL
FT                   TLGLTLASRAWVHYWDSVEARRKAKASPIPSLIADERIVLVIGGAGYIGSGLLPRLLER
FT                   GYRVRLLDLLLFGKEPIAHVLHHPNLEIIQADFRQVDKVVEAMRGVDTVVHLGGLVGDP
FT                   ACALDENLTIEINLVATRTIAEIAKGMRVRRFIFASTCSVYGASDLVLDERSNLNPVSL
FT                   YARSKIASEQVLRQLQSDDFSVVILRFGTIYGLSGRTRFDLVVNLLTAKAVVDKKITVF
FT                   GGDQWRPFVHVDDAAHAVMLAVEAPKERVHNETFNVGSNEGNMTLGMVGELVKKLVPDA
FT                   ELIDSGRDGDRRNYRVDFSKIRNRLGFEPQWTVEQGIQQVIEALKSGKVRDYRSAMYSN
FT                   VKYLTEGATSDAVKQYYLGWEKSLIQQTYEAKEEQGSATVPQA"
     MVAGSFAVAM VIHLLWAYRG AADAVLLGAY AQIYAKNVGI LMLIAFVVFA ASGFYSRGRA        60
     YQSRYKMLVV AQAVLLAYLI FGFAVFMLPL VDPPRSVLFA SGFLTLGLTL ASRAWVHYWD       120
     SVEARRKAKA SPIPSLIADE RIVLVIGGAG YIGSGLLPRL LERGYRVRLL DLLLFGKEPI       180
     AHVLHHPNLE IIQADFRQVD KVVEAMRGVD TVVHLGGLVG DPACALDENL TIEINLVATR       240
     TIAEIAKGMR VRRFIFASTC SVYGASDLVL DERSNLNPVS LYARSKIASE QVLRQLQSDD       300
     FSVVILRFGT IYGLSGRTRF DLVVNLLTAK AVVDKKITVF GGDQWRPFVH VDDAAHAVML       360
     AVEAPKERVH NETFNVGSNE GNMTLGMVGE LVKKLVPDAE LIDSGRDGDR RNYRVDFSKI       420
     RNRLGFEPQW TVEQGIQQVI EALKSGKVRD YRSAMYSNVK YLTEGATSDA VKQYYLGWEK       480
     SLIQQTYEAK EEQGSATVPQ A                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page