(data stored in ACNUC7421 zone)

EMBL: CP001743.PE365

CP001743.PE365       Location/Qualifiers
FT   CDS             350395..353151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0370"
FT                   /product="Galactose oxidase"
FT                   /EC_number="1.1.3.9"
FT                   /note="PRIAM: Galactose oxidase; PFAM: Domain of unknown
FT                   function DUF1929; Kelch repeat protein; Fibronectin type
FT                   III domain protein; PA14 domain protein; Kelch
FT                   repeat-containing protein;
FT                   InterProIPR011498:IPR015202:IPR003961:IPR011658:IPR 006652;
FT                   SPTR: A8EDL8 Putative galactose oxidase; KEGG:
FT                   mxa:MXAN_5265 kelch domain protein; SMART: PA14 domain
FT                   protein; Kelch repeat-containing protein; Fibronectin type
FT                   III domain protein; PFAM: Kelch motif; Fibronectin type III
FT                   domain; Domain of unknown function (DUF1929); PA14 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27147"
FT                   /protein_id="ADD27147.1"
FT                   /translation="MKAILALPRVFLLVLALAFLGLTGCNTTRPPATPSNFQATPDATP
FT                   RVVLRWEAAAGATDYVLERRTNSGAFAVLGVVTNTDYTDESVDYSTTYTYRLTARNNAA
FT                   ASSPVEQSATTPARPLAAPDAPSNFQATPDDTPKVVLRWTAPERVARYVLERRTRDGSF
FT                   ATLSSTLPASTTEYTDEAVGSGTPYTYRLTPYNSAGSGSQATLQTDTPAYSEPGFTQTA
FT                   SSYSFSDDRPAGQDPGINPLTSPDLGLDVEYFDNPDLTGLFARRIETNINHTFSGQPPR
FT                   PGMGPDTFSIRWTGLITAPASGTYTFTVLADDGVRLWVNDQLLISAWFDQNLTRRSATI
FT                   SLSAGQAYRIKLEYYNQDARGAIKLRWAYPGQSEQVVPPSAFVRHQKARIGYFGPKLPW
FT                   PTVATHAALLPDGRVMTFHGLDPVGKGQGDNYRDYSKHASTQVFVWTPGTPTDAQSQAR
FT                   YDNTRTDLFCSGYVLAANGKLYLAGGNLGYDYTASGGEYGFPAGHKHTNIFDPSTNTWS
FT                   AGPDMTYGRWYPSVITLPNEEMLIIGGNRDQHNGDGDIYRQDWNTIPDVWNPFTNTLRR
FT                   LTGAESIDINGNVLINHFYPWVHVAPNGQVFLSGNYEKWFYINTTGQGSLGPVHSSLVD
FT                   RYYGSSVMYQPGKILILGGGDVQKSNPPGISRGENSAQVIELNPNNQSISVRNVAPMAY
FT                   KRTHVNATLMPDGRIFVNGGNEDGIQFSNATAVYESEIWSPLTETFKRAAEAQCPRTYH
FT                   STALLLLDGTIITMGGGATGGDDLPNLPECDKTKGNEQKVNQLNAEIYYPPYLHNADGS
FT                   LASRPVVQSAPDRISYGQSFALTTDVPATAVERVTLVAFGAVTHAFNMGQRFIELNFTR
FT                   TGPNSLQVTAPASPNLATPGFYQLYVLDGRGVPSEARVVRLRDASLP"
     MKAILALPRV FLLVLALAFL GLTGCNTTRP PATPSNFQAT PDATPRVVLR WEAAAGATDY        60
     VLERRTNSGA FAVLGVVTNT DYTDESVDYS TTYTYRLTAR NNAAASSPVE QSATTPARPL       120
     AAPDAPSNFQ ATPDDTPKVV LRWTAPERVA RYVLERRTRD GSFATLSSTL PASTTEYTDE       180
     AVGSGTPYTY RLTPYNSAGS GSQATLQTDT PAYSEPGFTQ TASSYSFSDD RPAGQDPGIN       240
     PLTSPDLGLD VEYFDNPDLT GLFARRIETN INHTFSGQPP RPGMGPDTFS IRWTGLITAP       300
     ASGTYTFTVL ADDGVRLWVN DQLLISAWFD QNLTRRSATI SLSAGQAYRI KLEYYNQDAR       360
     GAIKLRWAYP GQSEQVVPPS AFVRHQKARI GYFGPKLPWP TVATHAALLP DGRVMTFHGL       420
     DPVGKGQGDN YRDYSKHAST QVFVWTPGTP TDAQSQARYD NTRTDLFCSG YVLAANGKLY       480
     LAGGNLGYDY TASGGEYGFP AGHKHTNIFD PSTNTWSAGP DMTYGRWYPS VITLPNEEML       540
     IIGGNRDQHN GDGDIYRQDW NTIPDVWNPF TNTLRRLTGA ESIDINGNVL INHFYPWVHV       600
     APNGQVFLSG NYEKWFYINT TGQGSLGPVH SSLVDRYYGS SVMYQPGKIL ILGGGDVQKS       660
     NPPGISRGEN SAQVIELNPN NQSISVRNVA PMAYKRTHVN ATLMPDGRIF VNGGNEDGIQ       720
     FSNATAVYES EIWSPLTETF KRAAEAQCPR TYHSTALLLL DGTIITMGGG ATGGDDLPNL       780
     PECDKTKGNE QKVNQLNAEI YYPPYLHNAD GSLASRPVVQ SAPDRISYGQ SFALTTDVPA       840
     TAVERVTLVA FGAVTHAFNM GQRFIELNFT RTGPNSLQVT APASPNLATP GFYQLYVLDG       900
     RGVPSEARVV RLRDASLP                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page