(data stored in ACNUC7421 zone)

EMBL: CP001743.PE366

CP001743.PE366       Location/Qualifiers
FT   CDS             complement(353148..354590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3111 hypothetical protein; SPTR:
FT                   A6C2D0 Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27148"
FT                   /protein_id="ADD27148.1"
FT                   /translation="MRQLFFLLLVGLITACATDQSAPSPSSSSNQAPSIRILSPSNGAT
FT                   VSGAGTRAEVSISDDKAVTRLTRQVNGGPEQDIAIQPTQSGNIIFWIPLVSGSNTAVIR
FT                   VYDAEGLSASATLNLQVGGSSSGGSGGGSFGTDYGGYTLPSGPTYYVSPSGSNANDGSR
FT                   ERPWATLSFAVQKLKPGDVLRVLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQG
FT                   NLFGIDVRGSYVDIVGFEVTNATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGVNMS
FT                   SPDSSDGVMLGNLVHDIGDLSAGFCTRIHGIYQGAPRGLVQNNITYRARGFGITSWHAA
FT                   TAVTISNNLSFANLYGGISVGSGDNTRGNRAENFLVANNIVVGNPRGISEEGNTGVNRF
FT                   VNNLVWNNTTNWRLQTSTQQGSLSLDPGFVNFQPDGSGNYTLQSSSPAIDKGITERAPA
FT                   IDFQAKPRLQGSAPDLGPFEVR"
     MRQLFFLLLV GLITACATDQ SAPSPSSSSN QAPSIRILSP SNGATVSGAG TRAEVSISDD        60
     KAVTRLTRQV NGGPEQDIAI QPTQSGNIIF WIPLVSGSNT AVIRVYDAEG LSASATLNLQ       120
     VGGSSSGGSG GGSFGTDYGG YTLPSGPTYY VSPSGSNAND GSRERPWATL SFAVQKLKPG       180
     DVLRVLPGSY NESVQVTASG TSSQRITIAS DIRWGAKLNA QGNLFGIDVR GSYVDIVGFE       240
     VTNATNSGII SWAPYNRFLF NHVYGIRAQC DSNGGAGVNM SSPDSSDGVM LGNLVHDIGD       300
     LSAGFCTRIH GIYQGAPRGL VQNNITYRAR GFGITSWHAA TAVTISNNLS FANLYGGISV       360
     GSGDNTRGNR AENFLVANNI VVGNPRGISE EGNTGVNRFV NNLVWNNTTN WRLQTSTQQG       420
     SLSLDPGFVN FQPDGSGNYT LQSSSPAIDK GITERAPAID FQAKPRLQGS APDLGPFEVR       480
//

If you have problems or comments...

PBIL Back to PBIL home page