(data stored in ACNUC7421 zone)

EMBL: CP001743.PE368

CP001743.PE368       Location/Qualifiers
FT   CDS             complement(355818..356090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27150"
FT                   /protein_id="ADD27150.1"
FT                   /translation="MESARPYLLKMHTPTNPLKRFEEAPPKSREALLKLWAALGPRVRT
FT                   ADPTRYYAVQEALELDIPFPVLVLYVFRECRRALEDNPIQERLAE"
     MESARPYLLK MHTPTNPLKR FEEAPPKSRE ALLKLWAALG PRVRTADPTR YYAVQEALEL        60
     DIPFPVLVLY VFRECRRALE DNPIQERLAE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page