(data stored in ACNUC7421 zone)

EMBL: CP001743.PE369

CP001743.PE369       Location/Qualifiers
FT   CDS             complement(356137..357036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0374"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; SPTR: Q5UXM4 NADH
FT                   dehydrogenase/oxidoreductase-like protein;
FT                   InterProIPR013120:IPR002225:IPR005913:IPR008030:IPR 001509;
FT                   COGs: COG0702 nucleoside-diphosphate-sugar epimerase; KEGG:
FT                   ppd:Ppro_0490 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27151"
FT                   /protein_id="ADD27151.1"
FT                   /translation="MKVLIVGGSGYVGTHMAQHLLERGHQVTVASRRGEGPLSGVRYVM
FT                   ADAAKNEGLLEAAQGQEALIYLVGIIRERGDQTFRQAHVDGVRHSLAAAKAAGIARFVH
FT                   MSALGTARGTGSRYYETKAEGEELVQASRLDWTILRPSLIFGQGDEFFGGILKGLVTAP
FT                   IPFIPLIGDGRFVFRPIWVGDVAAAFEQALGRPNTIHRSYNLVGPKEYTFRELLLLVRD
FT                   TLGSRKPLLSIPLTLMDWVVPLISPLPFSPITRDQYLQLKMGNTADPVHMRHAFALEER
FT                   SLETELPKILSAKRLVGA"
     MKVLIVGGSG YVGTHMAQHL LERGHQVTVA SRRGEGPLSG VRYVMADAAK NEGLLEAAQG        60
     QEALIYLVGI IRERGDQTFR QAHVDGVRHS LAAAKAAGIA RFVHMSALGT ARGTGSRYYE       120
     TKAEGEELVQ ASRLDWTILR PSLIFGQGDE FFGGILKGLV TAPIPFIPLI GDGRFVFRPI       180
     WVGDVAAAFE QALGRPNTIH RSYNLVGPKE YTFRELLLLV RDTLGSRKPL LSIPLTLMDW       240
     VVPLISPLPF SPITRDQYLQ LKMGNTADPV HMRHAFALEE RSLETELPKI LSAKRLVGA        299
//

If you have problems or comments...

PBIL Back to PBIL home page