(data stored in ACNUC7421 zone)

EMBL: CP001743.PE37

CP001743.PE37        Location/Qualifiers
FT   CDS             32316..33224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0038"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; SPTR: A6C767 NosX
FT                   protein, putative; InterPro IPR003374; COGs: COG1477
FT                   Membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis; KEGG: sus:Acid_5642 ApbE family lipoprotein;
FT                   PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26819"
FT                   /protein_id="ADD26819.1"
FT                   /translation="MPLALFKPRPYRHQAHYEGVLGTTLTLQVRARGSQQARAAEAAVL
FT                   AEIDRLERIFSSFSPESEFARWQAQGVAQLSPELQALLRAAEGWMAHTHGAFNPAAAAI
FT                   QALYRQNPEPAEGELEALRRALQGPLWRLEGRTAHKLTALPLTLNALAKGHIADRAAQA
FT                   AVAQGAEEVLLNLGGEIRHIGSQPVRVAVANPWAGADNALPLARLTICSQGVATSGRSQ
FT                   RGAHLFDPRTARPATQVVQATVVAPDAATADVLATAFCVLEPMLSLALAEVFGVGCLLV
FT                   EANGRTHTNPRFAQEETEVTR"
     MPLALFKPRP YRHQAHYEGV LGTTLTLQVR ARGSQQARAA EAAVLAEIDR LERIFSSFSP        60
     ESEFARWQAQ GVAQLSPELQ ALLRAAEGWM AHTHGAFNPA AAAIQALYRQ NPEPAEGELE       120
     ALRRALQGPL WRLEGRTAHK LTALPLTLNA LAKGHIADRA AQAAVAQGAE EVLLNLGGEI       180
     RHIGSQPVRV AVANPWAGAD NALPLARLTI CSQGVATSGR SQRGAHLFDP RTARPATQVV       240
     QATVVAPDAA TADVLATAFC VLEPMLSLAL AEVFGVGCLL VEANGRTHTN PRFAQEETEV       300
     TR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page