(data stored in ACNUC7421 zone)

EMBL: CP001743.PE370

CP001743.PE370       Location/Qualifiers
FT   CDS             complement(357044..357634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0375"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; SPTR: A4AEI3
FT                   Transcriptional regulator, Crp/Fnr family protein; KEGG:
FT                   scl:sce3757 CRP family global nitrogen regulatory protein;
FT                   COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR001808:IPR000595:IPR012318; PFAM:
FT                   Bacterial regulatory proteins, crp family; Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27152"
FT                   /protein_id="ADD27152.1"
FT                   /translation="MKKVRRKEVIYRAGDRADALYHLERGLVRIIEILPDGRQLTLRHV
FT                   LPGDYFGEEVLSERQYKYTAEALTDAAAFAVDPQTLSSDDLRALAASLASQMAQVQAYE
FT                   THLQWGELRSRICRYLLYLAATAAQGQDERGIYVTASHEEIADATASTRESVSKLLSDL
FT                   RHEGILDTGYRKIYLVDRKTLELEAESRMLQAV"
     MKKVRRKEVI YRAGDRADAL YHLERGLVRI IEILPDGRQL TLRHVLPGDY FGEEVLSERQ        60
     YKYTAEALTD AAAFAVDPQT LSSDDLRALA ASLASQMAQV QAYETHLQWG ELRSRICRYL       120
     LYLAATAAQG QDERGIYVTA SHEEIADATA STRESVSKLL SDLRHEGILD TGYRKIYLVD       180
     RKTLELEAES RMLQAV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page