(data stored in ACNUC7421 zone)

EMBL: CP001743.PE371

CP001743.PE371       Location/Qualifiers
FT   CDS             complement(357705..358586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0376"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; cobalamin B12-binding
FT                   domain protein; SMART: regulatory protein MerR; InterPro
FT                   IPR000551:IPR006158; KEGG: bba:Bd0931 MerR family
FT                   transcriptional regulator; COGs: COG0789 transcriptional
FT                   regulator protein; SPTR: A6GDQ0 B12 binding
FT                   domain/transcriptional regulator, MerR family protein;
FT                   PFAM: B12 binding domain; MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27153"
FT                   /protein_id="ADD27153.1"
FT                   /translation="MRNDLGVYTIAEVEERTGLSSALLRQWERRYGFPRPERSPGGHRL
FT                   YSQTDLEALRHIKKWIAEGVAPAQAVRRYLEGLTQEGPRPPEALSMELEEALLRADTEA
FT                   AERTLSEAYRLHPMETVVMEVIAPCLRRIGDGWHLGRVSTAQEHFASTYLRGTLHGLLN
FT                   LMGGSLGPTLVVSTLPGEQHEIGSLITALFLRRAGYTVHYLGPNTPLADLRSFAERTGA
FT                   KAVVLSAVQPVSLESLPHNALRHLAPVVVVGGRAAASDPHLVERLGAYYLGNDPRELAE
FT                   MLSVTLKEAGLW"
     MRNDLGVYTI AEVEERTGLS SALLRQWERR YGFPRPERSP GGHRLYSQTD LEALRHIKKW        60
     IAEGVAPAQA VRRYLEGLTQ EGPRPPEALS MELEEALLRA DTEAAERTLS EAYRLHPMET       120
     VVMEVIAPCL RRIGDGWHLG RVSTAQEHFA STYLRGTLHG LLNLMGGSLG PTLVVSTLPG       180
     EQHEIGSLIT ALFLRRAGYT VHYLGPNTPL ADLRSFAERT GAKAVVLSAV QPVSLESLPH       240
     NALRHLAPVV VVGGRAAASD PHLVERLGAY YLGNDPRELA EMLSVTLKEA GLW              293
//

If you have problems or comments...

PBIL Back to PBIL home page