(data stored in ACNUC7421 zone)

EMBL: CP001743.PE374

CP001743.PE374       Location/Qualifiers
FT   CDS             360320..360532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0379"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; InterPro IPR002145; KEGG: gme:Gmet_A3570 CopG-like
FT                   DNA-binding protein; SPTR: A4BU88 Putative uncharacterized
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27156"
FT                   /protein_id="ADD27156.1"
FT                   /translation="MLAIRLPKEIEERLEALAQKTGRSKSYYVRQAILEHLDDLEDYYL
FT                   ALERLEQNLPGIPLDEVERRLGLQD"
     MLAIRLPKEI EERLEALAQK TGRSKSYYVR QAILEHLDDL EDYYLALERL EQNLPGIPLD        60
     EVERRLGLQD                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page