(data stored in ACNUC7421 zone)

EMBL: CP001743.PE375

CP001743.PE375       Location/Qualifiers
FT   CDS             360516..360785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0380"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; InterPro
FT                   IPR007712:IPR012753; KEGG: rru:Rru_A3196 plasmid
FT                   stabilization system protein; COGs: COG2026 Cytotoxic
FT                   translational repressor of toxin-antitoxin stability
FT                   system; SPTR: A7BAH6 Putative uncharacterized protein;
FT                   PFAM: Plasmid stabilisation system protein; TIGRFAM:
FT                   addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27157"
FT                   /protein_id="ADD27157.1"
FT                   /translation="MGYRIEFDPRAEGELAKLDREVARRIVRFLRERVASLDDPRSIGE
FT                   ALHGPELGRFWKYRVGDYRLICHIQDQRVTVLVLRIGHRQVVYR"
     MGYRIEFDPR AEGELAKLDR EVARRIVRFL RERVASLDDP RSIGEALHGP ELGRFWKYRV        60
     GDYRLICHIQ DQRVTVLVLR IGHRQVVYR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page