(data stored in ACNUC7421 zone)

EMBL: CP001743.PE377

CP001743.PE377       Location/Qualifiers
FT   CDS             362480..363673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0382"
FT                   /product="Lycopene beta and epsilon cyclase"
FT                   /note="PFAM: Lycopene beta and epsilon cyclase; FAD
FT                   dependent oxidoreductase; SPTR: A4BXN5 Putative lycopene
FT                   cyclase; InterPro IPR006076:IPR008671; COGs: COG0644
FT                   Dehydrogenase (flavoprotein); KEGG: pub:SAR11_0122 lycopene
FT                   cyclase; PFAM: FAD dependent oxidoreductase; TIGRFAM:
FT                   lycopene cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27159"
FT                   /protein_id="ADD27159.1"
FT                   /translation="MSAAYDYDYIIVGAGAAGLSLAYHLVQAGLHDRRILLLERAPKTL
FT                   NDRTWCFWEVGEGPFEPVVFRRWNRIWFYGEGLSERLEIAPYAYKMIRGLDFYNFMHRW
FT                   MAKQPNVRLHYGEVTRLEEAPQGVRVEAGGQVFTGRWAFSSLYQPAPRQPGYHYLLQHF
FT                   KGWVVRTPRPAFDTGAATFMDFRVPQEGAVRFAYVLPFDARTALVEYTLFSPELLPPDA
FT                   YDAGLRAYLEGPLGLAQYEVLETEFGVIPMTDAPFARRPSPHVMNIGTAGGCTKASTGY
FT                   TFRRIQQQARRIAEALAQTGQPFFPEPTFNRYAYMDSVLLNVLAHRRSPGKQVFSDLFR
FT                   KNPPQRVLRFLDEKTSLLEDLQIMSSVDIPAFLRAALAVGRSRWPLARSGRMEPRRG"
     MSAAYDYDYI IVGAGAAGLS LAYHLVQAGL HDRRILLLER APKTLNDRTW CFWEVGEGPF        60
     EPVVFRRWNR IWFYGEGLSE RLEIAPYAYK MIRGLDFYNF MHRWMAKQPN VRLHYGEVTR       120
     LEEAPQGVRV EAGGQVFTGR WAFSSLYQPA PRQPGYHYLL QHFKGWVVRT PRPAFDTGAA       180
     TFMDFRVPQE GAVRFAYVLP FDARTALVEY TLFSPELLPP DAYDAGLRAY LEGPLGLAQY       240
     EVLETEFGVI PMTDAPFARR PSPHVMNIGT AGGCTKASTG YTFRRIQQQA RRIAEALAQT       300
     GQPFFPEPTF NRYAYMDSVL LNVLAHRRSP GKQVFSDLFR KNPPQRVLRF LDEKTSLLED       360
     LQIMSSVDIP AFLRAALAVG RSRWPLARSG RMEPRRG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page