(data stored in ACNUC7421 zone)

EMBL: CP001743.PE379

CP001743.PE379       Location/Qualifiers
FT   CDS             364836..365525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0384"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; InterPro IPR002123;
FT                   KEGG: mxa:MXAN_0902 acyltransferase domain protein; SPTR:
FT                   A1HTW7 1-acyl-sn-glycerol-3-phosphate acyltransferases;
FT                   PFAM: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27161"
FT                   /protein_id="ADD27161.1"
FT                   /translation="MMRPWERLLSVAFKALFRRTVQRGLRGVWVRGALPGQACVLAGNH
FT                   HSWWDGYLLPVLFWGGGRPFKIVVGERRLQEFAFFRRLDTVSASKPREALAALGRGEVL
FT                   IVFPEGELRPPGPLGGLNRGVVWFAERAGVSVVPVASRVVLRGHELAEAYLVFGAPIEP
FT                   DLRLLREQLERMLAELDDQIRTAPAEEPLPGFELRLAGRRSTHERMAAWGAALGKLIGL
FT                   AERKGAP"
     MMRPWERLLS VAFKALFRRT VQRGLRGVWV RGALPGQACV LAGNHHSWWD GYLLPVLFWG        60
     GGRPFKIVVG ERRLQEFAFF RRLDTVSASK PREALAALGR GEVLIVFPEG ELRPPGPLGG       120
     LNRGVVWFAE RAGVSVVPVA SRVVLRGHEL AEAYLVFGAP IEPDLRLLRE QLERMLAELD       180
     DQIRTAPAEE PLPGFELRLA GRRSTHERMA AWGAALGKLI GLAERKGAP                   229
//

If you have problems or comments...

PBIL Back to PBIL home page