(data stored in ACNUC7421 zone)

EMBL: CP001743.PE38

CP001743.PE38        Location/Qualifiers
FT   CDS             33221..33757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0039"
FT                   /product="periplasmic protein"
FT                   /note="SPTR: A6C767 NosX protein, putative; InterPro
FT                   IPR006311; COGs: COG3656 periplasmic protein; KEGG:
FT                   sus:Acid_5642 ApbE family lipoprotein; PFAM: Predicted
FT                   periplasmic protein (DUF2271)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26820"
FT                   /protein_id="ADD26820.1"
FT                   /translation="MKRSLISRRNFIHRSIGLVLTLWAGQSLAQTRWAGMKLDITFEFV
FT                   GNGFRYRPPYVAVWLEDAQGLPVRTLAVWFEQSRKGPRWLNELRRWYRSNEPTEAVSGP
FT                   TRMPGRYTLSWDGKDDKGNLVNQGDYYVCVELVREHGPYELFREKVILAQTPFKRSYNV
FT                   AGELKEVSLSYDRQG"
     MKRSLISRRN FIHRSIGLVL TLWAGQSLAQ TRWAGMKLDI TFEFVGNGFR YRPPYVAVWL        60
     EDAQGLPVRT LAVWFEQSRK GPRWLNELRR WYRSNEPTEA VSGPTRMPGR YTLSWDGKDD       120
     KGNLVNQGDY YVCVELVREH GPYELFREKV ILAQTPFKRS YNVAGELKEV SLSYDRQG         178
//

If you have problems or comments...

PBIL Back to PBIL home page