(data stored in ACNUC7421 zone)

EMBL: CP001743.PE381

CP001743.PE381       Location/Qualifiers
FT   CDS             366615..367970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0386"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; amine oxidase;
FT                   SPTR: A6DYH8 Amine oxidase; InterPro
FT                   IPR000759:IPR002937:IPR006076; COGs: COG1233 Phytoene
FT                   dehydrogenase and related protein; KEGG: bra:BRADO1614
FT                   hydroxyneurosporene and rhodopin dehydrogenase; PFAM: FAD
FT                   dependent oxidoreductase; TIGRFAM: phytoene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27163"
FT                   /protein_id="ADD27163.1"
FT                   /translation="MKAIVIGAGFAGLAAALRLRKAGLEVTVLEQFNQPGGKAIGWEGV
FT                   PTGPTVLTLPEIPRRIFAAFGAVLPELKPVSPLTRYTWPDGRVFAPELDLEATLAQLSL
FT                   REARHYQRLLRVARAMYEGARGTFIEGTPPHLAQLLRYALRDGLKAHPTRSLAALVQSG
FT                   PYLTPFFLRFATYLGANPYRAPAVLHNIAWVELGLGVFHLAGGMRALADHLFRLALAQG
FT                   VEFLFGQRVLQMQRLPGRVDALQTDQGWHRADLYISAADRHFTLKWLGLPLPGYALGVS
FT                   GFALLLKLAEAVPLGHHIYFSPDYRAEWQAIAAGRWPQDPTLYLHTDGEAAFLLVNAPP
FT                   MGRAEPPEAEGYARLLLDKLAQVHPLPIAAWRAMSPQDYSLTAYRGALYGRAPHGLLGA
FT                   LRPGWGVAGLRNFAQVGGTVHPGGGVPLSMLSGWNGAGWLLDRTRGGNGLEP"
     MKAIVIGAGF AGLAAALRLR KAGLEVTVLE QFNQPGGKAI GWEGVPTGPT VLTLPEIPRR        60
     IFAAFGAVLP ELKPVSPLTR YTWPDGRVFA PELDLEATLA QLSLREARHY QRLLRVARAM       120
     YEGARGTFIE GTPPHLAQLL RYALRDGLKA HPTRSLAALV QSGPYLTPFF LRFATYLGAN       180
     PYRAPAVLHN IAWVELGLGV FHLAGGMRAL ADHLFRLALA QGVEFLFGQR VLQMQRLPGR       240
     VDALQTDQGW HRADLYISAA DRHFTLKWLG LPLPGYALGV SGFALLLKLA EAVPLGHHIY       300
     FSPDYRAEWQ AIAAGRWPQD PTLYLHTDGE AAFLLVNAPP MGRAEPPEAE GYARLLLDKL       360
     AQVHPLPIAA WRAMSPQDYS LTAYRGALYG RAPHGLLGAL RPGWGVAGLR NFAQVGGTVH       420
     PGGGVPLSML SGWNGAGWLL DRTRGGNGLE P                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page