(data stored in ACNUC7421 zone)

EMBL: CP001743.PE383

CP001743.PE383       Location/Qualifiers
FT   CDS             complement(369084..369647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0388"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: A8CRT4
FT                   GCN5-related N-acetyltransferase; InterPro IPR000182; COGs:
FT                   COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: bca:BCE_2976 acetyltransferase;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27165"
FT                   /protein_id="ADD27165.1"
FT                   /translation="MTLSNTWPRHGKVTLKPFTEALTETEWRRFYECFRDPEIAEWNGS
FT                   RPLRMPLWLFKRVVMGEVSRGDRMGFGILDENGEWLGTVELYEMSRTEATLGILIGAKD
FT                   RWGQGYGTDAVRAVLEYAFCTLRLQKVRLRTYKHNLRAQRAFQKAGFRYLEPPPAPTPR
FT                   FNFGLAPKAEFVPMEITREDWTCY"
     MTLSNTWPRH GKVTLKPFTE ALTETEWRRF YECFRDPEIA EWNGSRPLRM PLWLFKRVVM        60
     GEVSRGDRMG FGILDENGEW LGTVELYEMS RTEATLGILI GAKDRWGQGY GTDAVRAVLE       120
     YAFCTLRLQK VRLRTYKHNL RAQRAFQKAG FRYLEPPPAP TPRFNFGLAP KAEFVPMEIT       180
     REDWTCY                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page