(data stored in ACNUC7421 zone)

EMBL: CP001743.PE389

CP001743.PE389       Location/Qualifiers
FT   CDS             complement(374242..374883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0394"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; SPTR: Q5SHS3 Redox-sensing transcriptional
FT                   repressor rex; InterPro IPR009718:IPR003781; COGs: COG2344
FT                   AT-rich DNA-binding protein; KEGG: dvl:Dvul_2068
FT                   redox-sensing transcriptional repressor REX; PFAM: CoA
FT                   binding domain; Putative DNA-binding protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27171"
FT                   /protein_id="ADD27171.1"
FT                   /translation="MAKVPSAAISRLVTYLRILEDLEARGINRTSSEQLAEEAQVTAFQ
FT                   VRKDLSYFGSYGTRGVGYTVQVLRRELRQILGLNRRWGLCIVGMGRLGQAIADYPGFSE
FT                   IFELRGLFDRDPSKITTTFRGLQVESMDNLPRAIAERRIEFGLLAVPADSAQAVADRLV
FT                   ESGIKGILNFAPAVLEVPKEVAVENVDFLTGLSRLSFFVLNPKWREEMIG"
     MAKVPSAAIS RLVTYLRILE DLEARGINRT SSEQLAEEAQ VTAFQVRKDL SYFGSYGTRG        60
     VGYTVQVLRR ELRQILGLNR RWGLCIVGMG RLGQAIADYP GFSEIFELRG LFDRDPSKIT       120
     TTFRGLQVES MDNLPRAIAE RRIEFGLLAV PADSAQAVAD RLVESGIKGI LNFAPAVLEV       180
     PKEVAVENVD FLTGLSRLSF FVLNPKWREE MIG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page