(data stored in ACNUC7421 zone)

EMBL: CP001743.PE396

CP001743.PE396       Location/Qualifiers
FT   CDS             complement(380353..381000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27178"
FT                   /protein_id="ADD27178.1"
FT                   /translation="MTPRDLYPLYRPLASRLHSGEVEGIPYLLQPNCPLLLANTAFGYL
FT                   EAAQKELEARFRAVGAPPAFTVLEGSETSALLASGYQATAAFELCQSEPSPRAHWTEQV
FT                   PWSEAWSIARILTEAYQAPQWRFALAERVGKLLQDPHSQAFVAYLYGDAVGAILTHQNI
FT                   GLLAGVVPPRLGNGVGAALVGRIHPRLFVRLAGTEAELPGRVLSRFIRYALE"
     MTPRDLYPLY RPLASRLHSG EVEGIPYLLQ PNCPLLLANT AFGYLEAAQK ELEARFRAVG        60
     APPAFTVLEG SETSALLASG YQATAAFELC QSEPSPRAHW TEQVPWSEAW SIARILTEAY       120
     QAPQWRFALA ERVGKLLQDP HSQAFVAYLY GDAVGAILTH QNIGLLAGVV PPRLGNGVGA       180
     ALVGRIHPRL FVRLAGTEAE LPGRVLSRFI RYALE                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page