(data stored in ACNUC7421 zone)

EMBL: CP001743.PE397

CP001743.PE397       Location/Qualifiers
FT   CDS             complement(380997..381914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0402"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; InterPro
FT                   IPR013822:IPR000897:IPR003593:IPR004390; KEGG: noc:Noc_1934
FT                   cell division transporter substrate-binding protein FtsY;
FT                   COGs: COG0552 Signal recognition particle GTPase; SPTR:
FT                   P83749 Cell division protein ftsY; PFAM: SRP54-type
FT                   protein, helical bundle domain; SRP54-type protein, GTPase
FT                   domain; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27179"
FT                   /protein_id="ADD27179.1"
FT                   /translation="MSWLQRLKEGLSKTRDNLVKAIPWGEDPEAVLEELEFALIAADVG
FT                   VEATQEVLEEVRQSGKKDLREALKQALTVQLEPDRFRAKIRKAGFNPNAKKSTVEPAGK
FT                   VILMVGVNGVGKTTTIAKLGQYYQSKGRSVMFCAGDTFRAAGGAQLGLWGERLGIPVIQ
FT                   GPEGSDPAALAFDAASARKARGLDLLLVDTAGRLHTKHNLMEELAKVKRSIAKADPGEP
FT                   GEVWLVLDAVTGQNGLEQAKKFHQTVGLTGVIVTKLDGTAKGGVLVPIVRTLGVPIKFI
FT                   GVGEKADDLQPFDAGEFVEALLGA"
     MSWLQRLKEG LSKTRDNLVK AIPWGEDPEA VLEELEFALI AADVGVEATQ EVLEEVRQSG        60
     KKDLREALKQ ALTVQLEPDR FRAKIRKAGF NPNAKKSTVE PAGKVILMVG VNGVGKTTTI       120
     AKLGQYYQSK GRSVMFCAGD TFRAAGGAQL GLWGERLGIP VIQGPEGSDP AALAFDAASA       180
     RKARGLDLLL VDTAGRLHTK HNLMEELAKV KRSIAKADPG EPGEVWLVLD AVTGQNGLEQ       240
     AKKFHQTVGL TGVIVTKLDG TAKGGVLVPI VRTLGVPIKF IGVGEKADDL QPFDAGEFVE       300
     ALLGA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page