(data stored in ACNUC7421 zone)

EMBL: CP001743.PE398

CP001743.PE398       Location/Qualifiers
FT   CDS             381979..382929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0403"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein; InterPro
FT                   IPR006070:IPR005145:IPR004388; KEGG: rsq:Rsph17025_2463
FT                   SUA5/YciO/YrdC/YwlC family protein; COGs: COG0009 Putative
FT                   translation factor (SUA5); SPTR: A6C3T1 Sua5 related
FT                   protein; PFAM: yrdC domain; SUA5 domain; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27180"
FT                   /protein_id="ADD27180.1"
FT                   /translation="MVVPPTPENLERAAQIIRSGGLVAFPTETVYGLGANALDARAAAR
FT                   IFEAKQRPSFDPLIVHVADRGMLQKVVQEVPALAERLMERFWPGPLTLVLPRSERVPGL
FT                   VTSGLPTVAVRMPAHPVAQELIRRAGLPLAAPSANPFGYLSPTRAEHVERMLGGRVDLI
FT                   LDGGRTEFGVESTIVLLAEKPTVLRYGAVAVEELERVLGRLELQVGAREKPLVPGQLPQ
FT                   HYAPHTPIRIAPPSEIPLGLRKRVGYLAFQEVPKGFKVVKVLSPTGSLLEAAAHLFEAL
FT                   HQLDRLGLEAIYAEPIPEVGLGRAIMDRLRRASSA"
     MVVPPTPENL ERAAQIIRSG GLVAFPTETV YGLGANALDA RAAARIFEAK QRPSFDPLIV        60
     HVADRGMLQK VVQEVPALAE RLMERFWPGP LTLVLPRSER VPGLVTSGLP TVAVRMPAHP       120
     VAQELIRRAG LPLAAPSANP FGYLSPTRAE HVERMLGGRV DLILDGGRTE FGVESTIVLL       180
     AEKPTVLRYG AVAVEELERV LGRLELQVGA REKPLVPGQL PQHYAPHTPI RIAPPSEIPL       240
     GLRKRVGYLA FQEVPKGFKV VKVLSPTGSL LEAAAHLFEA LHQLDRLGLE AIYAEPIPEV       300
     GLGRAIMDRL RRASSA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page