(data stored in ACNUC7421 zone)

EMBL: CP001743.PE4

CP001743.PE4         Location/Qualifiers
FT   CDS             4406..5830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0004"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; PRIAM: Pyruvate kinase;
FT                   PFAM: Pyruvate kinase barrel; Pyruvate kinase alpha/beta;
FT                   SPTR: A7CAK5 Pyruvate kinase; KEGG: acr:Acry_0178 pyruvate
FT                   kinase; COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR015794:IPR001697; PFAM: Pyruvate kinase,
FT                   alpha/beta domain; Pyruvate kinase, barrel domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26786"
FT                   /protein_id="ADD26786.1"
FT                   /translation="MGLLKRTKIVATLGPASRSPEVIRALIEAGVDVFRLNFSHGVPED
FT                   HRASVQMIREASSALGRTVAILQDLQGPKIRCGRFREGAVELQPGQKFIITAEPVEGDE
FT                   TRVSTTYRGLPNDVTPGQILLLDDGNIRLRVDEVRINDIHTTVLVGGRLSNNKGINIPG
FT                   ADLSIPALTDKDIDDIALGAELEVDWVAISFVRSRDDLLLARHYLTRHNSRARLMAKIE
FT                   KPSAVARFDEILEEADGIMVARGDLGVEMPLEEVPAVQKRIILKSVQAGKAVITATQML
FT                   ESMIKNPSPTRAEASDVANAIFDGTDAVMLSAETAAGQYPVEAVSFMTRVAKTIEATQE
FT                   YKDRLNALRPPATRTVQDAIARAVDDVVESTGAKAVVVFTSSGGAARRVARTRPPVPIL
FT                   ALTPNPHVRNQLALVSDVLPLLAPDPKDTDDMVQIAVAKAKETGLAEVGEYVVIAAGVP
FT                   FGVRGTTNMIRVERVS"
     MGLLKRTKIV ATLGPASRSP EVIRALIEAG VDVFRLNFSH GVPEDHRASV QMIREASSAL        60
     GRTVAILQDL QGPKIRCGRF REGAVELQPG QKFIITAEPV EGDETRVSTT YRGLPNDVTP       120
     GQILLLDDGN IRLRVDEVRI NDIHTTVLVG GRLSNNKGIN IPGADLSIPA LTDKDIDDIA       180
     LGAELEVDWV AISFVRSRDD LLLARHYLTR HNSRARLMAK IEKPSAVARF DEILEEADGI       240
     MVARGDLGVE MPLEEVPAVQ KRIILKSVQA GKAVITATQM LESMIKNPSP TRAEASDVAN       300
     AIFDGTDAVM LSAETAAGQY PVEAVSFMTR VAKTIEATQE YKDRLNALRP PATRTVQDAI       360
     ARAVDDVVES TGAKAVVVFT SSGGAARRVA RTRPPVPILA LTPNPHVRNQ LALVSDVLPL       420
     LAPDPKDTDD MVQIAVAKAK ETGLAEVGEY VVIAAGVPFG VRGTTNMIRV ERVS             474
//

If you have problems or comments...

PBIL Back to PBIL home page