(data stored in ACNUC7421 zone)

EMBL: CP001743.PE400

CP001743.PE400       Location/Qualifiers
FT   CDS             383687..384844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0405"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="PFAM: protein of unknown function Met10; SMART: PUA
FT                   domain containing protein; InterPro IPR003402:IPR002478;
FT                   KEGG: gsu:GSU2626 hypothetical protein; COGs: COG1092
FT                   SAM-dependent methyltransferase; SPTR: A5TUK5 Possible
FT                   methyltransferase; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27182"
FT                   /protein_id="ADD27182.1"
FT                   /translation="MNRVIAKAGKGKKVRNFYPGLFADELASVPEQAGVVQVYSEEEGF
FT                   LGVGYYDPQSRVAVRVYRFDEGPLDKRFFLQRFERAQKKRAQLDPFHRLVHAEADGLPG
FT                   LVVDRFGGVLVVQVRNRAMEALRAHWLPALIEALQPASIYERSDVDSRRQEGLPERVGV
FT                   LYGEAPSVLEVQEDGLVFQIPLALAQKTGYYLDQRENRRRLEQVVGPGERVLDVYSYVG
FT                   AFALRAARKGAYALAVDKDLDALAVLDRAASMQGLRVDIRQGDAVAVLEDLARGKTPPF
FT                   RHVLLDPPTLVKKPDELPRVKRLLVDLLRPALRLLDREGWLWLSSCAYYLGVDALLEVT
FT                   RRAAADEGRRLRVHAVHYNPPDHPWSLHVPESLYLKTVVFQDDPL"
     MNRVIAKAGK GKKVRNFYPG LFADELASVP EQAGVVQVYS EEEGFLGVGY YDPQSRVAVR        60
     VYRFDEGPLD KRFFLQRFER AQKKRAQLDP FHRLVHAEAD GLPGLVVDRF GGVLVVQVRN       120
     RAMEALRAHW LPALIEALQP ASIYERSDVD SRRQEGLPER VGVLYGEAPS VLEVQEDGLV       180
     FQIPLALAQK TGYYLDQREN RRRLEQVVGP GERVLDVYSY VGAFALRAAR KGAYALAVDK       240
     DLDALAVLDR AASMQGLRVD IRQGDAVAVL EDLARGKTPP FRHVLLDPPT LVKKPDELPR       300
     VKRLLVDLLR PALRLLDREG WLWLSSCAYY LGVDALLEVT RRAAADEGRR LRVHAVHYNP       360
     PDHPWSLHVP ESLYLKTVVF QDDPL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page