(data stored in ACNUC7421 zone)

EMBL: CP001743.PE403

CP001743.PE403       Location/Qualifiers
FT   CDS             complement(386188..387504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0408"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   SPTR: A3ZAV8 Carboxyl-terminal processing protease; KEGG:
FT                   carboxy-terminal protease ; K03797 carboxyl-terminal
FT                   processing protease; InterPro
FT                   IPR001478:IPR005151:IPR004447; PRIAM: C-terminal processing
FT                   peptidase; PFAM: peptidase S41; PDZ/DHR/GLGF domain
FT                   protein; COGs: COG0793 Periplasmic protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: Peptidase family S41; PDZ
FT                   domain (Also known as DHR or GLGF); TIGRFAM: C-terminal
FT                   peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27185"
FT                   /protein_id="ADD27185.1"
FT                   /translation="MKRRAWLIVLGGILAALVYAQLSGGVAEAFNRNPYGQALVQTYQL
FT                   LQTQYLTRLEPDQLNRVLEGGIRGMLGALEDEFTSYSPPQRASLRNQDIQGEFFGIGAT
FT                   LAPNENGGGARVQGVIRGLPAFNAGIRAGDIIVEVNGQDVTKLDLNEIVAQIRGPQNTK
FT                   VTIGIRREGTNAILRFEMIRQRVEIISVSKTILPGNVGYVALETFGNVRVIEQLNAALN
FT                   ELKQRGVQKLVFDLRDNGGGLLDQGCQVARAFIREGPIVYTRTRNETRLYCEANGQVTW
FT                   SGPMVVLINGNSASASEIVAGAMQDTGRAKVIGETSFGKGVGQNVIDLANGGDLTLVTF
FT                   EWLTPKRRGINKQGIKPDIEVKDTRFEVPVAFEGTGAKPGETVTITIGGQTFTTKADAQ
FT                   GKFNFSQPRPAVNLPAERGQAEVDLNKDAILRRALEELR"
     MKRRAWLIVL GGILAALVYA QLSGGVAEAF NRNPYGQALV QTYQLLQTQY LTRLEPDQLN        60
     RVLEGGIRGM LGALEDEFTS YSPPQRASLR NQDIQGEFFG IGATLAPNEN GGGARVQGVI       120
     RGLPAFNAGI RAGDIIVEVN GQDVTKLDLN EIVAQIRGPQ NTKVTIGIRR EGTNAILRFE       180
     MIRQRVEIIS VSKTILPGNV GYVALETFGN VRVIEQLNAA LNELKQRGVQ KLVFDLRDNG       240
     GGLLDQGCQV ARAFIREGPI VYTRTRNETR LYCEANGQVT WSGPMVVLIN GNSASASEIV       300
     AGAMQDTGRA KVIGETSFGK GVGQNVIDLA NGGDLTLVTF EWLTPKRRGI NKQGIKPDIE       360
     VKDTRFEVPV AFEGTGAKPG ETVTITIGGQ TFTTKADAQG KFNFSQPRPA VNLPAERGQA       420
     EVDLNKDAIL RRALEELR                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page