(data stored in ACNUC7421 zone)

EMBL: CP001743.PE404

CP001743.PE404       Location/Qualifiers
FT   CDS             387614..388300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0409"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005286; KEGG:
FT                   mxa:MXAN_5748 putative cell division ABC transporter,
FT                   ATP-binding protein FtsE; COGs: COG2884 ATPase involved in
FT                   cell division; SPTR: A7VHN5 Putative uncharacterized
FT                   protein; PFAM: ABC transporter; TIGRFAM: cell division
FT                   ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27186"
FT                   /protein_id="ADD27186.1"
FT                   /translation="MIHFHRVMLEYPRTQTKALFDLNLEIKKGEFVFLVGHSGAGKSSL
FT                   LNLILKRLEPTSGAVYFAGENLKALHGDRIALHRRRIGVVFQDHRLLRDRTVEENLLFT
FT                   LHVLGVPRHEWDLRVTRVLRQVGIVHKKRAYPDELSVGEAQRVAIARALVGDPQVLLAD
FT                   EPTGNLDPANALAVLEIFKLVHARGATVLVATHSRDLVEAYPQRVVVLKAGQLVRDDRE
FT                   GRYSLV"
     MIHFHRVMLE YPRTQTKALF DLNLEIKKGE FVFLVGHSGA GKSSLLNLIL KRLEPTSGAV        60
     YFAGENLKAL HGDRIALHRR RIGVVFQDHR LLRDRTVEEN LLFTLHVLGV PRHEWDLRVT       120
     RVLRQVGIVH KKRAYPDELS VGEAQRVAIA RALVGDPQVL LADEPTGNLD PANALAVLEI       180
     FKLVHARGAT VLVATHSRDL VEAYPQRVVV LKAGQLVRDD REGRYSLV                    228
//

If you have problems or comments...

PBIL Back to PBIL home page